KEGG   Mus musculus (mouse): 14693Help
Entry
14693             CDS       T01002                                 

Gene name
Gnb2, Gnb-2
Definition
guanine nucleotide binding protein (G protein), beta 2
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14693 (Gnb2)
   04151 PI3K-Akt signaling pathway
    14693 (Gnb2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    14693 (Gnb2)
  Nervous system
   04724 Glutamatergic synapse
    14693 (Gnb2)
   04727 GABAergic synapse
    14693 (Gnb2)
   04725 Cholinergic synapse
    14693 (Gnb2)
   04728 Dopaminergic synapse
    14693 (Gnb2)
   04726 Serotonergic synapse
    14693 (Gnb2)
   04723 Retrograde endocannabinoid signaling
    14693 (Gnb2)
  Environmental adaptation
   04713 Circadian entrainment
    14693 (Gnb2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    14693 (Gnb2)
   05034 Alcoholism
    14693 (Gnb2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14693 (Gnb2)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [Table]
    14693 (Gnb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5 76.54 cM
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggccgagcagctccggaaccagatccgggac
gccagaaaagcatgcggggattccacactgacccagatcacagctgggctggacccagtg
gggcgaattcagatgagaacacggaggaccctccgtggacacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagcgcctcccaggacggaaagctcatc
atttgggacagctacaccactaacaaggtccacgccatccctctgcgttcctcctgggtc
atgacctgtgcctacgccccctcagggaactttgtggcctgtgggggtttggacaacatc
tgctccatctatagtctcaagacccgagagggcaatgtcagggtcagcagagagctgcct
ggccacactgggtacctgtcatgctgccgcttcctggacgacaaccaaatcatcaccagc
tctggggacaccacctgtgccctgtgggacattgagacaggccagcagacggtggggttt
gctggacacagtggggatgtgatgtccctgtcactggcccccgatggccgcacctttgtg
tcaggtgcctgtgacgcctccatcaagctgtgggatgttcgggattccatgtgccgacag
acattcataggtcacgagtcggacatcaatgccgtggctttcttccccaatggctatgcc
ttcaccacgggatcagatgacgccacttgtcgcctctttgacctgcgggctgatcaggag
ctgctcatgtattcccacgacaacatcatctgcggcatcacctcggttgccttctcgcgc
agcggccggctgctgctcgctggctacgacgacttcaactgcaacatctgggatgccatg
aagggtgaccgtgcaggtgtcctcgctggccatgataaccgtgtgagctgccttggggtc
acagatgatggaatggccgtggctacaggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system