KEGG   Mus musculus (mouse): 14762Help
Entry
14762             CDS       T01002                                 

Gene name
Gpr33
Definition
(RefSeq) G protein-coupled receptor 33
  KO
K08382  
G protein-coupled receptor 33
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Chemokine
   Chemokine like
    14762 (Gpr33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12; 12 C1
AA seq 339 aa AA seqDB search
MDLINSSTHVINVSTSLTNSTGVPTPAPKTIIAASLFMAFIIGVISNGLYLWMLQFKMQR
TVNTLLFFHLILSYFISTLILPFMATSFLQDNHWVFGSVLCKAFNSTLSVSMFASVFFLS
AISVARYYLILHPVWSQQHRTPHWASRIALQIWISATILSIPYLVFRTTHDDHKGRIKCQ
NNYIVSTDWESKEHQTLGQWIHAACFVGRFLLGFLLPFLVIIFCYKRVATKMKEKGLFKS
SKPFKVMVTAVISFFVCWMPYHVHSGLVLTKSQPLPLHLTLGLAVVTISFNTVVSPVLYL
FTGENFKVFKKSILALFNSTFSDISSTERTQTLNSETEI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatttgatcaactcctccactcatgtgatcaatgtgtctacctcgttaacaaacagc
actggtgttccaactcctgcccccaaaacaatcattgctgcttctttgttcatggcattt
ataattggtgtcatcagcaacggcctctatctatggatgctgcaattcaagatgcaaagg
actgtcaatactcttttatttttccatctcattctctcctattttatttccacattgatt
ctgcccttcatggccacctccttccttcaggacaatcactgggtctttggaagtgtcttg
tgcaaagccttcaacagcactttgtcggtgagcatgtttgcctctgttttcttcctctcc
gccatcagtgttgctcgttattacctcattcttcatccagtgtggtcccagcagcaccga
accccacactgggcttcccggattgccttgcaaatctggatttctgccactatcctcagc
ataccctatttagttttcaggacaacacatgatgaccacaaaggaagaattaaatgccag
aataactacattgtgtctactgactgggagagcaaagagcatcaaacactagggcaatgg
attcatgcagcctgtttcgtcggccgcttcttgctgggtttccttctgcctttccttgtc
atcatcttttgctacaaacgagtggccaccaagatgaaagagaagggactctttaaatcc
agcaagcccttcaaagtcatggtgactgctgtcatctctttctttgtgtgttggatgccc
taccatgtacacagtggcttggtcctcactaagagtcagccattacctttacacttgaca
ctgggacttgcagtggtgactatttcttttaatactgtggtttctcctgttctctatcta
ttcactggggagaatttcaaggttttcaagaaatctattcttgctctctttaactcaaca
ttcagtgatatctcttctacagaaaggacacaaaccctgaactcagaaactgaaatttaa

DBGET integrated database retrieval system