KEGG   Mus musculus (mouse): 14764Help
Entry
14764             CDS       T01002                                 

Gene name
Ptgdr2, Crth2, Gpr44, Grp45
Definition
(RefSeq) prostaglandin D2 receptor 2
  KO
K06715  
G protein-coupled receptor 44
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Chemokine
   Chemokine like
    14764 (Ptgdr2)
Cellular antigens [BR:mmu04090]
 Proteins
  14764 (Ptgdr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19; 19 A
AA seq 382 aa AA seqDB search
MANVTLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM
RQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFL
LSAISLDRCLQVVRPVWAQNHRTVAVAHRVCLMLWALAVLNTIPYFVFRDTIPRLDGRIM
CYYNLLLWNPGPDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLRLHHRGRQRT
GRFVRLVAAIVVAFVLCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNP
LLYVFTCPDMLYKLRRSLRAVLESVLVEDSDQSGGLRNRRRRASSTATPASTLLLADRIP
QLRPTRLIGWMRRGSAEVPQRV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgtcacactgaagccgctctgtccactcttggaggagatggtccagcttcca
aaccacagcaactctagcctccgctacatcgaccacgtgtcggtgctgttgcacgggctg
gcctcgctgctgggcctggtggaaaacggactcatcctgtttgtggtgggctgtcgcatg
cgccagacagtggtcaccacctgggtgctgcacctggcgctatccgacttgttagccgcc
gcctccctgcctttcttcacctacttcctggcagtgggccactcgtgggagctgggcact
accttctgcaagctacattcctcggtcttcttcctcaacatgtttgccagcggcttcctg
ctcagtgccattagcctggaccgctgcctgcaggtggtgaggccagtgtgggcacagaac
caccgcacggtggcggtcgcgcacagagtctgcctgatgctctgggctctggcggtgctc
aacacaataccatatttcgtgttcagagacaccatcccgcggcttgatggccgcatcatg
tgctactacaacttgctgctctggaatccagggcctgaccgcgacaccacgtgcgactac
cgccagaaggccctggcggtcagcaaattcctgctggccttcatggtacctctggccata
attgcctcgagccacgtagccgtgagcctgcgactgcaccaccgtggtcgccagaggaca
ggccgctttgtgcgcctggtggcggccatcgtggttgccttcgtgctctgctgggggccc
taccacatcttcagtctgctggaggcgcgtgcccattctgtcaccacgctacggcagctc
gcgtcacgtgggctgccctttgtcaccagcctggccttcttcaacagcgtggtcaaccca
ctgctctatgtgttcacatgccccgacatgttgtacaaactgcggcgctcgctacgcgcg
gtgcttgaaagcgtgctggtagaagacagcgaccagagtggtgggctccgcaatcgccgt
cgccgcgcctcctccaccgccaccccagcctctaccctcctgctggctgaccgaattccc
caactgcgtccaacccgcttgatcggctggatgaggcgtggcagtgcagaggtcccacag
agggtctga

DBGET integrated database retrieval system