KEGG   Mus musculus (mouse): 14765Help
Entry
14765             CDS       T01002                                 

Gene name
Gpr50, H9
Definition
(RefSeq) G-protein-coupled receptor 50
  KO
K04287  
G protein-coupled receptor 50
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14765 (Gpr50)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Other
   Melatonin
    14765 (Gpr50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
X A7.2; X 36.98 cM
AA seq 591 aa AA seqDB search
MATVPKSNMGPTKAVPTPFGCIGCKLPKPDYPPALIIFMFCAMVITVVVDLIGNSMVILA
VTKNKKLRNSGNIFVASLSVADMLVAIYPYPLMLYAMSVGGWDLSQLQCQMVGLVTGLSV
VGSIFNITAIAINRYCYICHSLQYKRIFSLRNTCIYLVVTWVMTVLAVLPNMYIGTIEYD
PRTYTCIFNYVNNPAFTVTIVCIHFVLPLIIVGYCYTKIWIKVLAARDPAGQNPDNQFAE
VRNFLTMFVIFLLFAVCWCPVNVLTVLVAVIPKEMAGKIPNWLYLAAYCIAYFNSCLNAI
IYGILNESFRREYWTIFHAMRHPILFISHLISDIRETWETRALTRARVRARDQVREQERA
RACVAVEGTPRNVRNVLLPGDASAPHSDRASVRPKPQTRSTSVYRKPASIHHKSISGHPK
SASVYPKPASSVHCKPASVHFKPASVHFKGDSVYFKGDTVHYRAASKLVTSHRISAGPST
SHPTSMAGYIKSGTSHPATTTVDYLEPATTSHSVLTAVDLPEVSASHCLEMTSTGHLRAD
ISASVLPSVPFELAATPPDTTAIPIASGDYRKVVLIDDDSDDSDCSDEMAV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggccacggtccccaagagcaacatgggacctacaaaggcggttcccaccccattcggc
tgcattggctgtaagctgccaaagcccgactacccgccagctctaatcatcttcatgttc
tgcgcaatggtcatcacagtcgtcgtagacctgatcgggaactccatggtcattttggct
gtgaccaagaacaagaagctccgaaattctggcaacatctttgtggccagcctctctgtg
gcagacatgctggtggccatctacccctaccctttgatgctgtatgccatgtcagttggg
ggctgggatctgagtcagctccagtgccagatggtcgggttggtcacaggactgagcgta
gtcggttccatcttcaacattactgccattgccatcaaccgttactgctacatctgccac
agcctccaatacaagcggatcttcagcctgcgcaacacttgcatctatctggtcgttacc
tgggtcatgactgtcctggctgtcctgcctaacatgtacattggcaccattgagtatgac
cctcgcacctacacctgcatcttcaactatgtgaacaatcctgcctttaccgtgaccatt
gtctgcatccacttcgtcctccctctcatcatagttggttattgctacacgaaaatctgg
atcaaagtgctggcagcccgtgacccagctggacagaatcctgacaaccagtttgctgag
gttcgaaattttctaaccatgtttgtgatcttcctcctttttgcagtgtgctggtgccct
gtcaatgtgctcactgtgttggtggctgtcattccaaaggaaatggcaggcaagatcccc
aactggctttatcttgcagcctactgcatagcctacttcaacagctgcctcaacgccatc
atctacggtatcctcaatgagagtttccgaagagaatactggaccatcttccatgctatg
cggcaccctatcctgttcatctctcacctcatcagtgatattcgggagacttgggagacc
cgagctctcactcgtgcccgtgtccgtgcccgtgatcaagtccgagagcaagagcgtgct
cgtgcctgtgtcgctgtggaggggaccccaaggaacgtccggaatgttctactgcctggt
gatgcatcagcaccccactctgatcgtgcctctgtccgtcccaagccccaaaccaggtct
acttctgtctaccgcaaacctgcctctatccaccacaagtctatttctggccaccccaag
tctgcctctgtttaccctaagccagcctcctctgtccattgcaagcctgcctctgtccat
ttcaaacccgcctctgttcatttcaagggtgactctgtctatttcaagggagacactgtc
cattacagggctgcttccaaacttgtcaccagtcaccgtatctctgctggcccttccacc
agtcaccctacatccatggctggctacattaaatctggtaccagccaccctgccaccacc
actgttgactatctcgaacctgccaccaccagccactctgtgctcactgctgtcgacctc
cctgaggtctcagcctcccattgccttgagatgaccagcactggccacctcagagctgac
atttctgcctctgtccttccttctgtacccttcgagcttgctgccacccctcctgatacc
actgcaatccccattgcctctggtgattaccgcaaggtcgtgcttattgatgatgattct
gatgattctgattgctctgatgagatggctgtgtga

DBGET integrated database retrieval system