KEGG   Mus musculus (mouse): 14766Help
Entry
14766             CDS       T01002                                 

Gene name
Adgrg1, Cyt28, Gpr56, TM7LN4, TM7XN1
Definition
(RefSeq) adhesion G protein-coupled receptor G1
  KO
K08450  
G protein-coupled receptor 56
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class B. Secretin receptor family
  Other
   Putative / unclassified Class B GPCRs
    14766 (Adgrg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 D1; 8 47.12 cM
AA seq 687 aa AA seqDB search
MAVQVLRQMVYFLLSLFSLVQGAHSGSPREDFRFCGQRNQTQQSTLHYDQSSEPHIFVWN
TEETLTIRAPFLAAPDIPRFFPEPRGLYHFCLYWSRHTGRLHLRYGKHDYLLSSQASRLL
CFQKQEQSLKQGAPLIATSVSSWQIPQNTSLPGAPSFIFSFHNAPHKVSHNASVDMCDLK
KELQQLSRYLQHPQKAAKRPTAAFISQQLQSLESKLTSVSFLGDTLSFEEDRVNATVWKL
PPTAGLEDLHIHSQKEEEQSEVQAYSLLLPRAVFQQTRGRRRDDAKRLLVVDFSSQALFQ
DKNSSQVLGEKVLGIVVQNTKVTNLSDPVVLTFQHQPQPKNVTLQCVFWVEDPASSSTGS
WSSAGCETVSRDTQTSCLCNHLTYFAVLMVSSTEVEATHKHYLTLLSYVGCVISALACVF
TIAAYLCSRRKSRDYTIKVHMNLLSAVFLLDVSFLLSEPVALTGSEAACRTSAMFLHFSL
LACLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSIVGWGFPVFLVTLVALVDVNNYGPII
LAVRRTPERVTYPSMCWIRDSLVSYVTNLGLFSLVFLFNLAMLATMVVQILRLRPHSQNW
PHVLTLLGLSLVLGLPWALVFFSFASGTFQLVILYLFSIITSFQGFLIFLWYWSMRFQAQ
GGPSPLKNNSDSAKLPISSGSTSSSRI
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccaggtgctgcggcagatggtctacttcctactgagtctgttttctctggtg
caaggtgcacacagtggcagcccccgagaagacttccgcttctgtggccagcggaaccag
acccaacagagcaccctccactatgatcaatcttcagagcctcacatctttgtgtggaac
acagaggagaccctcacaattcgtgcccccttcctggcagccccagatattccccgcttc
ttcccagagcctagagggctctatcacttctgcctctactggagtcgccacactgggaga
ctccacttgcgctatggcaagcatgactacctgcttagtagccaagcctccagactcctc
tgcttccagaaacaggagcagagcctgaagcagggagccccgctgatcgccacctctgtc
agctcctggcagattccccagaacaccagcctgcctggggctccgagcttcatcttctcc
ttccacaatgccccacacaaggtctcccacaatgcatctgtggacatgtgtgatctcaag
aaggaattgcagcagcttagcaggtacctgcagcaccctcaaaaggctgccaagcggccc
accgcagcgttcatcagccagcagttacagagcctggagtcaaagctgacctctgtgagc
ttcctgggagacacattatcctttgaggaggaccgggtcaatgctacagtgtggaagctg
ccacccacagccggtctagaggatctgcatatccactcccagaaggaggaggagcagagt
gaggtccaggcatactcgctgttgcttccccgggccgtattccagcagaccagaggccgt
cgccgggatgacgccaagaggctcctggtagtagacttcagcagccaagctttgttccag
gacaagaattctagccaagtcctgggtgagaaggtcttgggtattgtcgtgcagaacacc
aaagtcaccaacctctcagatccggtggtactcaccttccagcaccagcctcagccaaaa
aatgtgactctgcagtgcgtgttctgggttgaagacccggcatcaagcagcacagggagc
tggagcagtgcaggctgcgagacagtgagcagagacacacagacatcctgcctgtgcaac
cacctgacctactttgcagtgctgatggtgtcatccacagaggtagaagccactcacaaa
cactacctcacgctcctgtcctacgtgggctgtgtcatctctgctctggcttgtgtcttc
actattgctgcctacctctgctccaggaggaagtcacgtgactacaccatcaaagtccac
atgaacctgctgtccgctgtcttcctgctggacgtgagcttcctgctcagcgagcctgtg
gcactgacgggctccgaagcagcctgtcgcaccagtgccatgttcctgcacttctccctg
cttgcctgcctctcctggatgggcctcgagggctacaatctctaccgactggtggtggag
gtcttcggtacctatgtgcccggctatctgctcaagctgagcatcgtgggctggggtttt
cctgtcttcctggtcactctggtggcgttggtggatgtgaataactacggccccattatc
ctagctgtgcgccggactccggaacgtgtcacctacccctctatgtgctggatccgggac
tccctggtgagctatgtcaccaacctgggcctcttcagtctggtgttcctgttcaacctg
gctatgctggccaccatggtggtgcagatcctgcggcttcgcccgcacagccagaactgg
ccccacgtgctgaccctgctgggcctcagcctggtccttggcctcccctgggccttggtc
ttcttttcctttgcttccggcaccttccagcttgtcatcctctacctcttcagcatcata
acttccttccaaggcttcctcatcttcctgtggtactggtccatgcggttccaggcccaa
ggcggcccctcccctctgaagaacaactcagacagcgccaaactccccatcagctccggc
agcacctcctccagccgcatctaa

DBGET integrated database retrieval system