KEGG   Mus musculus (mouse): 14767Help
Entry
14767             CDS       T01002                                 

Gene name
Nmur1, FM-3, Gpr66, NMU-R1, NMU1R, NmU-R
Definition
(RefSeq) neuromedin U receptor 1
  KO
K05052  
neuromedin U receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14767 (Nmur1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuromedin U
    14767 (Nmur1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 D
AA seq 428 aa AA seqDB search
MTPPCLNCSIFPGALSPNASRSPLVCNISEFKWPYQPEDLNLTDEALRLKYLGPQQMKQF
VPICVTYLLIFVVGTLGNGLTCTVILRNKTMRTPTNFYLFSLAVSDMLVLLVGLPLELYE
MQQNYPFQLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRPLQAKSVMTRAHVRR
MVGAIWVLATLFSLPNTSLHGLSQLTVPCRGPVPDSAICSLVGPMDFYKLVVLTTALLFF
CLPMVTISVLYLLIGLRLRRERMLLQVEVKGRKTAATQETSHRRIQLQDRGRRQVTKMLF
ALVVVFGICWAPFHADRIMWSLVYGHSTEGLHLAYQCVHIASGIFFYLGSAANPVLYSLM
STRFRETFLQALGLGTQCCHRRQPYHGSHNHIRLTTGSTLCDVGHRNSRDEPLAVNEDPG
CQQETDPS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgactcctccctgcctcaattgttccatctttcctggagcgctctccccaaatgcttca
aggagccccctggtctgcaatatcagtgagttcaagtggccctatcaacctgaggatctg
aaccttaccgatgaggccctgaggctgaagtatttggggccacagcagatgaaacagttt
gtccccatctgtgtcacgtacctgctgatcttcgtggtgggcactctgggcaacgggctg
acctgcaccgtcatcctgcgcaacaagactatgcgcacgcccaccaacttctacctcttc
agcctcgctgtgtccgatatgctggtgctcctggtgggcttgcctctggagctttatgag
atgcagcaaaattacccgttccagctgggtgcgagtgcctgctacttccgaatactgctc
ttagagaccgtctgcctagcttcagtgctcaatgtcacagccctgagtgtggagcgttat
gtggccgtggtgcgcccactccaagccaagtctgtgatgacacgggcccatgtgcgccgc
atggtgggggccatctgggtcctcgctactctcttctctctgcccaacaccagcctgcat
ggcctcagtcaactaactgtgccctgccgggggccggtgcccgactcagctatatgttcg
ctggtgggtcccatggacttctacaagttggtggtactgactaccgcactgctcttcttc
tgtctgcccatggtcaccatcagtgtgctgtatctgctcattgggctgcggctgcggagg
gagaggatgttgctccaagtggaggtcaagggcaggaaaaccgcagcaacccaggagacc
tcccacagaaggattcagctgcaagataggggacggagacaggtgaccaagatgctgttt
gcactggttgtggtattcggcatctgctgggctccattccatgctgaccgtatcatgtgg
agcctggtgtatggacactcaacggaaggcctgcacctggcctaccagtgtgtccacatt
gcctctggcatcttcttctatctcggctcagcagccaacccggtgctctacagcctcatg
tctactcgcttccgagagaccttcctgcaagccctgggccttggaacccagtgctgtcat
cgccgccaaccctatcatggctcccataaccacatcaggttgaccacaggcagcaccctg
tgtgacgtgggccacaggaacagcagggacgaacctctggctgtgaatgaggatccaggg
tgtcagcaagagacagacccctcctga

DBGET integrated database retrieval system