KEGG   Mus musculus (mouse): 14775Help
Entry
14775             CDS       T01002                                 

Gene name
Gpx1, AI195024, AL033363, CGPx, GPx-1, GSHPx-1, Gpx
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mmu00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:mmu04918]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:mmu05014]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mmu05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 F1; 9 59.24 cM
AA seq 201 aa AA seqDB search
MCAARLSAAAQSTVYAFSARPLTGGEPVSLGSLRGKVLLIENVASLUGTTIRDYTEMNDL
QKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKA
HPLFTFLRNALPTPSDDPTALMTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRR
FRTIDIEPDIETLLSQQSGNS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgctcggctctccgcggcggcacagtccaccgtgtatgccttctccgcgcgc
ccgctgacgggcggggagcctgtgagcctgggctccctgcggggcaaggtgctgctcatt
gagaatgtcgcgtctctctgaggcaccacgatccgggactacaccgagatgaacgatctg
cagaagcgtctgggacctcgtggactggtggtgctcggtttcccgtgcaatcagttcgga
caccaggagaatggcaagaatgaagagattctgaattccctcaagtacgtccgacctggt
ggcgggttcgagcccaattttacattgtttgagaagtgcgaagtgaatggtgagaaggct
cacccgctctttaccttcctgcggaatgccttgccaacacccagtgacgaccccactgcg
ctcatgaccgaccccaagtacatcatttggtctccggtgtgccgcaacgacattgcctgg
aactttgagaagttcctggtgggccccgacggtgttcccgtgcgcaggtacagccgccgc
tttcgtaccatcgacatcgaacctgacatagaaaccctgctgtcccagcagtctggcaac
tcctaa

DBGET integrated database retrieval system