KEGG   Mus musculus (mouse): 14775Help
Entry
14775             CDS       T01002                                 

Gene name
Gpx1, AI195024, AL033363, CGPx, GPx-1, GSHPx-1, Gpx
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    14775 (Gpx1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    14775 (Gpx1)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    14775 (Gpx1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    14775 (Gpx1)
   05016 Huntington's disease
    14775 (Gpx1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     14775 (Gpx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 F1; 9 59.24 cM
AA seq 201 aa AA seqDB search
MCAARLSAAAQSTVYAFSARPLTGGEPVSLGSLRGKVLLIENVASLUGTTIRDYTEMNDL
QKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKA
HPLFTFLRNALPTPSDDPTALMTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRR
FRTIDIEPDIETLLSQQSGNS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgctcggctctccgcggcggcacagtccaccgtgtatgccttctccgcgcgc
ccgctgacgggcggggagcctgtgagcctgggctccctgcggggcaaggtgctgctcatt
gagaatgtcgcgtctctctgaggcaccacgatccgggactacaccgagatgaacgatctg
cagaagcgtctgggacctcgtggactggtggtgctcggtttcccgtgcaatcagttcgga
caccaggagaatggcaagaatgaagagattctgaattccctcaagtacgtccgacctggt
ggcgggttcgagcccaattttacattgtttgagaagtgcgaagtgaatggtgagaaggct
cacccgctctttaccttcctgcggaatgccttgccaacacccagtgacgaccccactgcg
ctcatgaccgaccccaagtacatcatttggtctccggtgtgccgcaacgacattgcctgg
aactttgagaagttcctggtgggccccgacggtgttcccgtgcgcaggtacagccgccgc
tttcgtaccatcgacatcgaacctgacatagaaaccctgctgtcccagcagtctggcaac
tcctaa

DBGET integrated database retrieval system