KEGG   Mus musculus (mouse): 14776Help
Entry
14776             CDS       T01002                                 

Gene name
Gpx2, GI-GPx, GPx-GI, GSHPx-2, GSHPx-GI
Definition
glutathione peroxidase 2 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mmu00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:mmu04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12 C3; 12 33.73 cM
AA seq 190 aa AA seqDB search
MAYIAKSFYDLSAVGLDGEKIDFNTFRGRAVLIENVASLUGTTTRDYNQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFSLTQKCDVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRSFQTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacattgccaagtcgttctacgatctcagtgccgttggcctggatggggagaag
atagacttcaatacgttcagaggcagggctgtgctgattgagaatgtggcgtcactctga
ggaacaactacccgggactacaaccagctcaatgagctgcaatgtcgctttcccaggcgc
ctggtagttctcggcttcccttgcaaccagttcggacatcaggagaactgtcagaacgag
gagatcctgaacagcctcaagtatgtccgacctgggggtgggtaccagcccacctttagt
cttacccaaaagtgtgacgtcaatgggcagaacgagcatcctgtctttgcctacctgaaa
gacaagctgccctacccttatgatgacccgttctccctcatgaccgatcccaagctcatc
atatggagtcccgtgcgccgctcagacgtgtcctggaactttgagaagttcctcataggg
ccagaaggggagcccttccgtcgctacagccgcagcttccagaccatcaacatcgagcct
gacatcaaacggctcctcaaagttgccatctag

DBGET integrated database retrieval system