KEGG   Mus musculus (mouse): 14778Help
Entry
14778             CDS       T01002                                 

Gene name
Gpx3, AA960521, EGPx, GPx, GSHPx-3, GSHPx-P
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00590  Arachidonic acid metabolism
mmu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    14778 (Gpx3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    14778 (Gpx3)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    14778 (Gpx3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     14778 (Gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 14778
NCBI-ProteinID: NP_032187
MGI: 105102
Ensembl: ENSMUSG00000018339
Vega: OTTMUSG00000006337
UniProt: P46412
Position
11; 11 B1.3
AA seq 226 aa AA seqDB search
MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYA
GKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIR
WNFEKFLVGPDGIPVMRWYHRTTVSNVKMDILSYMRRQAALSARGK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggatcctccgggcatcctgccttctgtccctgctcctggccgggtttgttccg
ccgggccggggacaagagaagtctaagacagactgccatggcggtatgagtggtaccatc
tacgagtatggagccctcaccatcgatggggaggaatacattccttttaagcagtatgca
ggcaaatatatcctctttgtcaacgtagccagctactgaggtctgacagaccaatacctt
gaactgaatgcactacaagaagaacttgggccatttggcttggtcattctgggcttccct
tccaaccaatttggcaaacaggagccaggcgagaactcggagatactccccagtctcaag
tatgttcgaccaggtgggggctttgtgcctaatttccagctctttgagaaaggagatgtg
aacggggagaaagagcagaaattctacactttcctgaagaactcctgccctcccactgca
gaactcctgggctcacctggccgcctcttttgggaacccatgaagatccatgacatccgc
tggaactttgagaagttcctggtggggccagatggcataccggttatgcgctggtaccac
cggaccacagtcagcaacgtcaagatggacatcctgtcttacatgaggcggcaggcagcc
ctgagcgccagggggaagtaa

DBGET integrated database retrieval system