KEGG   Mus musculus (mouse): 14778Help
Entry
14778             CDS       T01002                                 

Gene name
Gpx3, AA960521, EGPx, GPx, GSHPx-3, GSHPx-P
Definition
glutathione peroxidase 3 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    14778 (Gpx3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    14778 (Gpx3)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    14778 (Gpx3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     14778 (Gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 B3-B5
AA seq 226 aa AA seqDB search
MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYA
GKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIR
WNFEKFLVGPDGIPVMRWYHRTTVSNVKMDILSYMRRQAALSARGK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggatcctccgggcatcctgccttctgtccctgctcctggccgggtttgttccg
ccgggccggggacaagagaagtctaagacagactgccatggcggtatgagtggtaccatc
tacgagtatggagccctcaccatcgatggggaggaatacattccttttaagcagtatgca
ggcaaatatatcctctttgtcaacgtagccagctactgaggtctgacagaccaatacctt
gaactgaatgcactacaagaagaacttgggccatttggcttggtcattctgggcttccct
tccaaccaatttggcaaacaggagccaggcgagaactcggagatactccccagtctcaag
tatgttcgaccaggtgggggctttgtgcctaatttccagctctttgagaaaggagatgtg
aacggggagaaagagcagaaattctacactttcctgaagaactcctgccctcccactgca
gaactcctgggctcacctggccgcctcttttgggaacccatgaagatccatgacatccgc
tggaactttgagaagttcctggtggggccagatggcataccggttatgcgctggtaccac
cggaccacagtcagcaacgtcaagatggacatcctgtcttacatgaggcggcaggcagcc
ctgagcgccagggggaagtaa

DBGET integrated database retrieval system