KEGG   Mus musculus (mouse): 14784Help
Entry
14784             CDS       T01002                                 

Gene name
Grb2, AA408164, Ash
Definition
(RefSeq) growth factor receptor bound protein 2
  KO
K04364  growth factor receptor-binding protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04062  Chemokine signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu05034  Alcoholism
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14784 (Grb2)
   04010 MAPK signaling pathway
    14784 (Grb2)
   04012 ErbB signaling pathway
    14784 (Grb2)
   04630 Jak-STAT signaling pathway
    14784 (Grb2)
   04068 FoxO signaling pathway
    14784 (Grb2)
   04072 Phospholipase D signaling pathway
    14784 (Grb2)
   04151 PI3K-Akt signaling pathway
    14784 (Grb2)
   04150 mTOR signaling pathway
    14784 (Grb2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    14784 (Grb2)
   04540 Gap junction
    14784 (Grb2)
   04550 Signaling pathways regulating pluripotency of stem cells
    14784 (Grb2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    14784 (Grb2)
   04660 T cell receptor signaling pathway
    14784 (Grb2)
   04662 B cell receptor signaling pathway
    14784 (Grb2)
   04664 Fc epsilon RI signaling pathway
    14784 (Grb2)
   04062 Chemokine signaling pathway
    14784 (Grb2)
  Endocrine system
   04910 Insulin signaling pathway
    14784 (Grb2)
   04912 GnRH signaling pathway
    14784 (Grb2)
   04915 Estrogen signaling pathway
    14784 (Grb2)
   04917 Prolactin signaling pathway
    14784 (Grb2)
   04926 Relaxin signaling pathway
    14784 (Grb2)
  Nervous system
   04722 Neurotrophin signaling pathway
    14784 (Grb2)
  Development
   04380 Osteoclast differentiation
    14784 (Grb2)
  Environmental adaptation
   04714 Thermogenesis
    14784 (Grb2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14784 (Grb2)
   05231 Choline metabolism in cancer
    14784 (Grb2)
   05206 MicroRNAs in cancer
    14784 (Grb2)
   05205 Proteoglycans in cancer
    14784 (Grb2)
   05203 Viral carcinogenesis
    14784 (Grb2)
   05210 Colorectal cancer
    14784 (Grb2)
   05225 Hepatocellular carcinoma
    14784 (Grb2)
   05226 Gastric cancer
    14784 (Grb2)
   05214 Glioma
    14784 (Grb2)
   05221 Acute myeloid leukemia
    14784 (Grb2)
   05220 Chronic myeloid leukemia
    14784 (Grb2)
   05211 Renal cell carcinoma
    14784 (Grb2)
   05215 Prostate cancer
    14784 (Grb2)
   05213 Endometrial cancer
    14784 (Grb2)
   05224 Breast cancer
    14784 (Grb2)
   05223 Non-small cell lung cancer
    14784 (Grb2)
  Substance dependence
   05034 Alcoholism
    14784 (Grb2)
  Infectious diseases
   05161 Hepatitis B
    14784 (Grb2)
   05160 Hepatitis C
    14784 (Grb2)
   05165 Human papillomavirus infection
    14784 (Grb2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    14784 (Grb2)
   01522 Endocrine resistance
    14784 (Grb2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    14784 (Grb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH2_2 hSH3 SH3_3 SH3_4 DUF5093
Motif
Other DBs
NCBI-GeneID: 14784
NCBI-ProteinID: NP_001300865
MGI: 95805
Ensembl: ENSMUSG00000059923
Vega: OTTMUSG00000003535
UniProt: Q60631 Q3U5I5 Q3U1Q4
Structure
PDB: 

Jmol
Position
11 E2; 11 80.91 cM
AA seq 217 aa AA seqDB search
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRG
DFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggaagccatcgccaaatatgacttcaaagctactgctgacgatgagctgagcttcaaa
aggggggacatccttaaggttttgaatgaagaatgtgaccagaactggtataaggcagaa
ctcaatgggaaagatggcttcatccccaagaattacatagaaatgaaaccacatccgtgg
ttttttggcaaaatccccagagccaaggcagaagaaatgctcagcaaacagcggcatgac
ggggccttcctgatccgagagagcgagagcgctcctggggacttctccctgtccgtcaag
tttggaaatgatgtgcagcacttcaaggtgctccgcgacggagccgggaagtatttcctg
tgggtggtgaagtttaattctttgaatgagctggtagattaccacagatcaacatccgtg
tccaggaaccagcagatattcttacgggacatagaacagatgccacagcagccaacctac
gtccaggcgctctttgactttgacccccaggaggatggcgagctgggctttcgcagagga
gacttcattcatgtcatggataactcagatcccaattggtggaaaggggcctgccacggg
cagaccggcatgtttccccgcaattatgtcaccccagtgaaccggaacgtctaa

DBGET integrated database retrieval system