KEGG   Mus musculus (mouse): 14784Help
Entry
14784             CDS       T01002                                 

Gene name
Grb2, AA408164, Ash
Definition
(RefSeq) growth factor receptor bound protein 2
  KO
K04364  
growth factor receptor-binding protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Dorso-ventral axis formation
Osteoclast differentiation
Focal adhesion
Gap junction
Signaling pathways regulating pluripotency of stem cells
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Hepatitis C
Hepatitis B
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14784 (Grb2)
   04010 MAPK signaling pathway
    14784 (Grb2)
   04012 ErbB signaling pathway
    14784 (Grb2)
   04630 Jak-STAT signaling pathway
    14784 (Grb2)
   04068 FoxO signaling pathway
    14784 (Grb2)
   04072 Phospholipase D signaling pathway
    14784 (Grb2)
   04151 PI3K-Akt signaling pathway
    14784 (Grb2)
   04150 mTOR signaling pathway
    14784 (Grb2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    14784 (Grb2)
   04540 Gap junction
    14784 (Grb2)
   04550 Signaling pathways regulating pluripotency of stem cells
    14784 (Grb2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    14784 (Grb2)
   04660 T cell receptor signaling pathway
    14784 (Grb2)
   04662 B cell receptor signaling pathway
    14784 (Grb2)
   04664 Fc epsilon RI signaling pathway
    14784 (Grb2)
   04062 Chemokine signaling pathway
    14784 (Grb2)
  Endocrine system
   04910 Insulin signaling pathway
    14784 (Grb2)
   04912 GnRH signaling pathway
    14784 (Grb2)
   04915 Estrogen signaling pathway
    14784 (Grb2)
   04917 Prolactin signaling pathway
    14784 (Grb2)
  Nervous system
   04722 Neurotrophin signaling pathway
    14784 (Grb2)
  Development
   04320 Dorso-ventral axis formation
    14784 (Grb2)
   04380 Osteoclast differentiation
    14784 (Grb2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14784 (Grb2)
   05231 Choline metabolism in cancer
    14784 (Grb2)
   05206 MicroRNAs in cancer
    14784 (Grb2)
   05205 Proteoglycans in cancer
    14784 (Grb2)
   05203 Viral carcinogenesis
    14784 (Grb2)
   05214 Glioma
    14784 (Grb2)
   05221 Acute myeloid leukemia
    14784 (Grb2)
   05220 Chronic myeloid leukemia
    14784 (Grb2)
   05211 Renal cell carcinoma
    14784 (Grb2)
   05215 Prostate cancer
    14784 (Grb2)
   05213 Endometrial cancer
    14784 (Grb2)
   05223 Non-small cell lung cancer
    14784 (Grb2)
  Substance dependence
   05034 Alcoholism
    14784 (Grb2)
  Infectious diseases
   05161 Hepatitis B
    14784 (Grb2)
   05160 Hepatitis C
    14784 (Grb2)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    14784 (Grb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11 E2; 11 80.91 cM
AA seq 217 aa AA seqDB search
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRG
DFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggaagccatcgccaaatatgacttcaaagctactgctgacgatgagctgagcttcaaa
aggggggacatccttaaggttttgaatgaagaatgtgaccagaactggtataaggcagaa
ctcaatgggaaagatggcttcatccccaagaattacatagaaatgaaaccacatccgtgg
ttttttggcaaaatccccagagccaaggcagaagaaatgctcagcaaacagcggcatgac
ggggccttcctgatccgagagagcgagagcgctcctggggacttctccctgtccgtcaag
tttggaaatgatgtgcagcacttcaaggtgctccgcgacggagccgggaagtatttcctg
tgggtggtgaagtttaattctttgaatgagctggtagattaccacagatcaacatccgtg
tccaggaaccagcagatattcttacgggacatagaacagatgccacagcagccaacctac
gtccaggcgctctttgactttgacccccaggaggatggcgagctgggctttcgcagagga
gacttcattcatgtcatggataactcagatcccaattggtggaaaggggcctgccacggg
cagaccggcatgtttccccgcaattatgtcaccccagtgaaccggaacgtctaa

DBGET integrated database retrieval system