KEGG   Mus musculus (mouse): 14791Help
Entry
14791             CDS       T01002                                 

Gene name
Emg1, C2f, Grcc2f
Definition
(RefSeq) EMG1 N1-specific pseudouridine methyltransferase
  KO
K14568  
rRNA small subunit pseudouridine methyltransferase Nep1 [EC:2.1.1.260]
Organism
mmu  Mus musculus (mouse)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    14791 (Emg1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.260  rRNA small subunit pseudouridine methyltransferase Nep1
     14791 (Emg1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    14791 (Emg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 F2; 6 59.17 cM
AA seq 244 aa AA seqDB search
MSAASGGFQPRERRFSVQEQDWETTPPKKLRLGAGSKCGGRRLIVVLEGASLETVKVGKT
YELLNCDRHKSMLLKNGRDPGEVRPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEV
NPQTRIPRTFDRFCGLMVQLLHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKIGTSFSV
EDISDIRELVPSSDPVVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKVTTAFEEV
WGVI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggccagtggtggcttccaacctcgtgagcggcgattttcagtgcaggagcag
gactgggagactacgccgcctaagaagctccggcttggggcaggaagcaagtgcggaggc
cggaggctcattgtggtgctggaaggggccagtctggagacagtcaaggtagggaaaact
tacgagctactcaactgtgacaggcacaagtccatgttgttgaagaatggacgggaccca
ggggaagtcagaccagacatcacccaccagagcctgctgatgcttatggacagccccctg
aaccgagctggcttgctacaggtttacatccacacacagaagaacgtgctgattgaagtg
aacccccagactcgaattcctagaacctttgaccgattttgtggcctcatggttcagctt
ttacacaaactgagcgtccgagcagccgacggccctcagaagctattgaaggtaattaag
aatccagtgtccgaccacttcccagttggctgtatgaaaattggcacttccttttctgtt
gaagacatcagtgacattcgagagttggtgcccagtagtgacccagttgtgtttgtggtg
ggggcctttgcccatggcaaggtcagtgtggagtacacagaaaagatggtgtccatcagc
aactatccactctctgctgcgcttacctgtgctaaagtcaccacagcttttgaagaagta
tggggtgtcatttga

DBGET integrated database retrieval system