KEGG   Mus musculus (mouse): 14799Help
Entry
14799             CDS       T01002                                 

Gene name
Gria1, 2900051M01Rik, Glr-1, Glr1, GluA1, GluR-A, GluRA, Glur-1, Glur1, HIPA1, gluR-K1
Definition
(RefSeq) glutamate receptor, ionotropic, AMPA1 (alpha 1)
  KO
K05197  
glutamate receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Long-term depression
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    14799 (Gria1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14799 (Gria1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    14799 (Gria1)
   04728 Dopaminergic synapse
    14799 (Gria1)
   04720 Long-term potentiation
    14799 (Gria1)
   04730 Long-term depression
    14799 (Gria1)
   04723 Retrograde endocannabinoid signaling
    14799 (Gria1)
  Environmental adaptation
   04713 Circadian entrainment
    14799 (Gria1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    14799 (Gria1)
  Substance dependence
   05031 Amphetamine addiction
    14799 (Gria1)
   05033 Nicotine addiction
    14799 (Gria1)
Ion channels [BR:mmu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   14799 (Gria1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B1.3; 11 34.51 cM
AA seq 907 aa AA seqDB search
MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGSGSGENGRVVSQDFPKSMQSIPCMSHSSGM
PLGATGL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacatctttgcctttttctgcaccggttttctaggtgcggttgtgggtgccaat
ttccccaacaatatccagatagggggattatttccaaaccaacaatcacaggaacatgcg
gcttttaggtttgctttgtcacaactcacggagccccccaagctgcttccccagatcgat
attgtgaacatcagcgacagctttgagatgacttaccgattctgttcccagttctccaaa
ggagtgtacgccatctttggattttatgaacgaaggactgtcaacatgctgacctccttc
tgtggggccctccatgtgtgcttcatcactccaagttttcccgttgacacatccaatcag
tttgtccttcagctgcgcccggaactacaggaagctctcattagcattatcgaccattac
aagtggcagacttttgtctacatttatgatgctgaccggggcctgtcagtcctgcagaga
gtcttggatacagccgccgagaagaactggcaggtgacggctgtcaacattctaacaacc
acggaggaaggataccggatgctctttcaggacctggagaagaaaaaggagaggctggtg
gtggtggactgtgaatcagaacgcctcaacgccatcctgggccagattgtgaagctagaa
aagaacggcatcgggtaccactacatcctcgccaacctgggcttcatggacattgactta
aataagttcaaggagagtggagccaatgtgacaggtttccaactggtgaactacacagac
acgatcccagccagaatcatgcagcagtggaggacaagtgacgctcgggaccacaccagg
gtggactggaagaggccaaagtacacttctgctcttacctatgatggtgtgaaggtgatg
gcggaggccttccagagcctgcggaggcagaggattgacatatcccggcgagggaatgct
ggggactgtctggctaacccagctgtgccctggggccaagggatcgacatccagagagcc
ctgcagcaggtgcgctttgaaggtttgacaggaaatgtgcagtttaacgagaaagggcgc
cggaccaactacaccctccatgtgatcgaaatgaagcatgatggaatccgcaagattggt
tactggaatgaagatgataaatttgtccccgcagccacggacgctcaggctggaggggac
aactcaagcgtccagaatagaacctacatcgtcacgactatcctcgaagatccttacgtg
atgcttaaaaagaatgccaaccaatttgaaggcaatgaccgctatgagggctactgcgtg
gaactggctgcggagatcgccaagcacgtgggctattcctaccgacttgagattgtcagc
gacggcaaatacggagcccgggatcctgacacaaaggcctggaatggcatggtgggagag
ctagtctatggaagagcagatgtggcggtggcccccttgaccataaccttggtccgggag
gaagtcatcgacttctccaagccattcatgagtttgggaatctccattatgattaagaag
ccacagaagtccaagccaggtgtcttctcctttcttgaccctttggcctacgagatctgg
atgtgtatagtgtttgcctacattggagtgagcgtcgtcctcttcctggtcagccgtttc
agtccttatgaatggcacagtgaagagtttgaagaaggacgagatcagacaaccagtgac
cagtcaaatgagtttggcatattcaacagcctgtggttctcgctgggggccttcatgcag
caaggatgtgacatttcccccaggtccctgtctggacgcatcgtcggcggtgtctggtgg
ttcttcactttgattatcatctcctcatacacagccaacctggctgccttcctgactgtg
gaaaggatggtgtctcccatcgagagtgcagaggacctggcaaagcagacggaaattgct
tatgggacattggaagcaggatccactaaggagttcttcaggaggtctaaaatcgctgtg
tttgagaagatgtggacatacatgaagtctgcagaaccgtctgtgtttgttcggaccaca
gaggagggcatgatcagagtgagaaagtctaaaggcaaatatgcctacctcctggagtcc
accatgaatgagtacattgagcaacgcaagccctgtgacaccatgaaagtgggaggtaac
ttggattccaaaggctatggcattgcaacacccaaggggtccgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagaccagtgct
ctgagcctgagcaatgtggcaggcgtgttctacatcctgattggagggctgggattggcc
atgctggttgccttaatcgagttctgctacaaatcccgtagcgagtcgaagcggatgaag
ggtttctgtttgattccacagcaatccatcaatgaagccatacggacatcgaccctcccc
aggaacagcggggcaggagccagcggaggaagtggcagtggagagaatggcagagtggtc
agccaggacttccccaagtccatgcaatccattccctgcatgagccacagttcagggatg
cccttgggagccacaggattgtaa

DBGET integrated database retrieval system