KEGG   Mus musculus (mouse): 14802Help
Entry
14802             CDS       T01002                                 

Gene name
Gria4, GluA4, GluR-D, Glur-4, Glur4, Gluralpha4, spkw1
Definition
glutamate receptor, ionotropic, AMPA4 (alpha 4)
Orthology
K05200  
glutamate receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14802 (Gria4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    14802 (Gria4)
   04728 Dopaminergic synapse
    14802 (Gria4)
   04723 Retrograde endocannabinoid signaling
    14802 (Gria4)
  Environmental adaptation
   04713 Circadian entrainment
    14802 (Gria4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    14802 (Gria4)
   05033 Nicotine addiction
    14802 (Gria4)
Ion channels [BR:mmu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   14802 (Gria4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 A1; 9 2.46 cM
AA seq 902 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDAPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcaggcagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccgagcagcgttcaaataggtggtctctttatccgaaacacagaccaggaa
tacactgcttttcggctagctatctttcttcataacaccagccccaatgcatctgaagcc
cctttcaatttggtacctcatgtggacaacattgagactgccaacagttttgctgtgaca
aatgcattctgttcccagtattctagaggggtgtttgccatttttggactctatgacaag
aggtcagtgcataccttgacctccttctgcagtgctctgcacatctctctcatcacacca
agcttccccactgaaggagagagccagttcgtgcttcagctaagaccttcattgagaggt
gcactcctgagcctcctggatcactatgaatggaattgttttgtcttcctgtatgataca
gacagggggtattcaatacttcaagctataatggaaaaagcaggacagaatggatggcat
gtcagtgcgatatgtgtggaaaattttaacgatgtcagctacaggcaactactagaagag
cttgacagaagacaagagaagaaatttgtaatagattgtgagatagaaaggcttcaaaac
atattagaacaaattgtgagtgttgggaagcacgtcaaaggctaccattatatcatcgca
aatttgggtttcaaagatatttctcttgagagatttatacatggaggagcaaatgtcact
ggattccagttagtagattttaatacgcccatggtgacgaaactaatggatcgctggaag
aaactagatcaacgagaatatccaggatctgaaacacctccaaagtacacttctgctctc
acttacgatggtgtcttggtaatggctgaaactttccgaagtctcagaagacagaaaatt
gatatttcaaggagaggaaatgccggggattgtctggcaaaccctgctgctccctggggc
cagggaattgacatggagagaacactgaagcaggttcgaattcaaggactgactgggaat
gttcaatttgaccactatggacgtagagttaattacacaatggatgtgtttgaattaaaa
agcacaggacctcgaaaggttggctattggaacgatatggataaattagtcttgattcaa
gatgcgcctactcttggcaatgacacagcagctatcgagaacagaacagtggttgtaacc
acaattatggaatccccctacgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtatgaaggctactgtgtagacttggcatctgaaattgcgaaacatatcggtatc
aaatataaaattgccattgtccctgatggaaaatatggagcaagggatgcggacaccaaa
atttggaatgggatggtaggagagcttgtgtatgggaaagcagagattgccattgcacct
ctgacaatcacgttggtgcgagaggaggtcatcgacttttctaagccttttatgagttta
ggcatctctatcatgatcaaaaaacctcagaaatctaaaccaggagtgttttccttcttg
gaccctctggcctatgagatctggatgtgcatagtgtttgcatacattggtgtcagcgtg
gtcttgttcctagtcagtaggtttagcccatatgagtggcacacagaagagcctgaggat
ggaaaagaaggacccagtgaccaacctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcctttatgcaacaaggatgtgacatttcacccagatccctgtccggt
cggattgttggaggcgtatggtggttcttcactctcatcattatctcatcctacactgct
aatctggctgcattcctgacagtggagagaatggtctcccccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacacttgattcgggatcaacaaaagaattc
ttcagaagatcaaaaatagcagtatatgaaaagatgtggacctacatgcgatcggcagag
ccatctgtgttcactagaactacagctgagggcgtggcccgtgtccgcaagtccaagggc
aaatttgccttcctcctggagtccacgatgaatgaatacattgagcagcgaaagccctgt
gacacgatgaaagtgggaggaaacctggattccaaaggctatggtgtagcgacgcccaag
ggttcctcattaggaaatgctgttaacctcgcagttttaaaactgaatgaacaaggcctc
ttggacaaattgaaaaacaaatggtggtacgacaaaggagaatgtggcagcgggggaggt
gactccaaggacaagacgagtgccttgagcctgagcaacgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaggcgaagagaatgaagctgactttttccgaagccataagaaacaaagccagg
ttatccatcactgggagtgtgggagaaaacggccgtgtgctgacccccgactgccccaag
gccgtacacacaggaactgcgattagacagagctcgggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system