KEGG   Mus musculus (mouse): 14803Help
Entry
14803             CDS       T01002                                 

Gene name
Grid1, GluD1, GluRdelta1
Definition
(RefSeq) glutamate receptor, ionotropic, delta 1
  KO
K05206  
glutamate receptor delta-1 subunit
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14803 (Grid1)
Ion channels [BR:mmu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   14803 (Grid1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14 B; 14 20.84 cM
AA seq 1009 aa AA seqDB search
MEALTLWLLPWICQCVTVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKI
TYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNP
GGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQS
FLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFI
NEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHR
ISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWN
GGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKG
LNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGF
KYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS
VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPRPS
ASATLHSAIWIVYGAFVQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSR
MDNPIRTFQDLSKQLEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADN
CVSNPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPY
RDLFSQRILELQDTGDLDVLKQKWWPHTGRCDLTSHSSTQTEGKSLKLHSFAGVFCILAI
GLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRINSLMDEDIAHKQISPASIEL
SALEMGGLAPSQALEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSAT
MPSIQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgttgacgctgtggcttcttccctggatatgccagtgcgttacggtgcgggcc
gactccatcatccacatcggtgccatcttcgaggagaacgcagccaaggacgacagggtg
ttccagttggctgtatcagacctgagcctcaatgatgacatcctgcagagtgagaagatc
acctactccatcaaggtcatcgaggccaataatccgttccaggcggtgcaagaagcctgt
gacctcatgacccagggaattttggccttggtcacatccacgggctgtgcatccgccaat
gccctgcagtccctcacagacgccatgcacatcccacacctctttgtccagcgcaacccc
gggggttcaccacgtactgcctgccacctgaaccctagccctgacggcgaggcctacaca
ctggcttcgagaccacctgtccgtctcaatgatgtcatgctcaggctggtgacagaactg
cgctggcagaagttcgtcatgttctatgacagcgagtatgatatccgtgggctccaaagc
ttcctggatcaggcctcaaggctgggtctggatgtctctttacaaaaggtggacaagaac
atcagtcacgtgttcactagccttttcaccaccatgaagaccgaggagctgaatcgctac
cgggacacactgcgccgtgccattctactgctcagcccacagggggcgcactccttcatc
aatgaggctgtggagaccaacttggcttccaaggacagccactgggtctttgtgaatgag
gaaatcagtgaccccgagatcctggatctggtccacagtgcccttggcaggatgaccgtg
gtccggcaaatcttcccatctgcaaaggacaaccagaaatgtatgaggaataaccaccgc
atctcctccctgctctgtgatccacaggaaggctacctccaaatgctgcagatctccaat
ctctacctgtatgacagtgttctgatgctggccaacgccttccacaggaagctggaagac
cggaagtggcatagtatggcaagccttaactgcatccggaagtctaccaagccatggaat
ggagggagatccatgctagacacgattaaaaagggacatatcactggcctcacaggggtt
atggagtttcgggaagatagctcaaatccttatgtccagtttgaaatccttggcacaacc
tatagtgagacttttggcaaagacatgcgcaagctggccacctgggactcggagaagggc
ttgaatggcagtctacaggagaggcccatgggcagccgcctccaaggactgactctcaaa
gtggtgactgtcttggaagagccttttgtgatggtagctgagaatatccttggacaaccc
aagcgttacaaagggttctccatagatgtgctggatgcactggctaaggctctaggattc
aaatatgagatataccaggcccctgatggcaggtatggtcaccagctccataacacctcc
tggaatgggatgatcggggagctcattagcaagagagcagacttggccatctctgctatt
accatcaccccagagagagagagcgttgtggacttcagcaagcgctacatggactactca
gtggggatcctcatcaagaagcctgaggagaagatcagcatcttttcccttttcgccccc
tttgactttgcggtgtgggcctgcattgccgcagccattcctgtggtgggcgtgctcata
ttcgtgttgaatcggatacaggctgtaagatctcagagtgccacccagccacgaccctcg
gcttctgccaccctgcacagtgccatttggattgtctatggagcctttgtccagcaaggt
ggtgagtcttcggtgaactctgtggccatgcgcatcgtgatgggcagctggtggctcttc
accctcattgtgtgttcctcctacacagccaacctggccgctttcctcacagtgtctagg
atggacaaccccataaggacatttcaggacctgtccaagcaactggagatgtcttatggc
actgtccgggactctgctgtctatgagtacttcagagccaaggggaccaatcccctggag
caggatagcacttttgctgagctctggcggaccataagcaagaatggaggggctgacaac
tgtgtgtccaatccttcagaaggtatcaggaaggcaaagaaggggaactacgcctttcta
tgggatgtggccgtggtggagtatgcagccctgacagatgacgactgctcagtgactgtc
atcggcaacagcatcagcagcaagggctacgggattgccctgcaacatggcagcccctac
agggaccttttctcccagaggatcctggagctgcaagacacaggggacctggatgtgctc
aagcagaagtggtggccacacacaggtcgatgtgacctcaccagccattccagtacccag
actgaaggcaaatcccttaagctgcacagcttcgctggggtcttctgcattttggccatt
ggcctccttcttgcctgcctcgtggctgctctagagttatggtggaacagcaaccggtgc
caccaggagacccccaaagaggacaaagaagtgaatctggagcaggtacaccggcgcatc
aacagcctcatggatgaagacattgctcacaagcaaatttccccagcgtccattgagctt
tctgccctagagatggggggcctggctccaagccaagctttggagcccacgagggagtac
cagaacacccagctctcagtcagcacctttctgccggagcagagcagccatggcaccagc
cggacactgtcgtcagggcccagcagcaacctgccactgccactgagcagctcagccact
atgccctcaattcagtgcaaacacaggtcgcccaatgggggactgtttcgacagagcccg
gtgaagacccccatccctatgtccttccagcccgtgcctggaggcgtccttccagaggct
ctggacacctctcatggcacctccatctga

DBGET integrated database retrieval system