KEGG   Mus musculus (mouse): 14804Help
Entry
14804             CDS       T01002                                 

Gene name
Grid2, B230104L07Rik, GluD2, GluRdelta2, Lc, Lc<J>, MMS10-AC, Ms10ac, cpr, ho, nmf408, tpr
Definition
(RefSeq) glutamate receptor, ionotropic, delta 2
  KO
K05207  
glutamate receptor delta-2 subunit
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Long-term depression
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14804 (Grid2)
 Organismal Systems
  Nervous system
   04730 Long-term depression
    14804 (Grid2)
Ion channels [BR:mmu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   14804 (Grid2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 C1; 6 29.77 cM
AA seq 1007 aa AA seqDB search
MEVFPLLLFLSFCWSRTWDLATADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQT
EKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQ
RSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLNEVILRVVTEYAWQKFIIFYDSEYDIRG
IQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAK
SFISEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
GNHRISSSLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNS
KPWQGGRSMLETIKKGGVNGLTGDLEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWN
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSN
YLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY
MDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITR
IESSIQSLQDLSKQTDIPYGTVLDSAVYQHVRMKGLNPFERDSMYSQMWRMINRSNGSEN
NVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIALQHGSPY
RDVFSQRILELQQSGDMDILKHKWWPKNGQCDLYSSVDAKQKGGALDIKSLAGVFCILAA
GIVLSCLIAVLETWWSRRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSI
DLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFAFGSVPEH
RTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atggaagttttccccttgctcttgtttctgtccttctgttggtctcgaacctgggacctg
gcgaccgctgattctatcatccacatcggagcaatttttgatgaatctgctaaaaaagat
gatgaagtattccgcacagcagttggtgacctcaaccagaatgaggaaatcttacagact
gagaaaatcacattttctgtgacgtttgttgatggcaacaacccttttcaagctgttcaa
gaagcatgtgaacttatgaaccagggcatcttggccttggtcagctccattggttgcaca
tcagctgggtccctccagtctttggcagatgccatgcatatcccccacctcttcattcag
cgctcaacagctgggaccccaagaagtggctgtggcctcacccggagcaacagaaatgat
gactatactctttcagttcgtccacctgtctacttgaatgaagtcatcctaagagtagtc
acagagtatgcatggcagaaatttattatcttctatgacagtgaatatgatatccgtgga
atccaggaatttttggacaaagtatcccagcagggaatggatgttgcccttcaaaaggtg
gaaaacaacatcaacaaaatgatcaccacactctttgacaccatgaggatagaggagttg
aatcgctatcgagacactcttagaagagccatccttgtcatgaatcctgccacagccaaa
tccttcataagtgaggtggtggagacgaatctggttgcttttgactgtcactggatcatc
attaatgaggaaataaatgatgtggatgttcaggaacttgtcagaaggtccattggaagg
ttaacaataattcggcagacatttccagtcccccagaatataagtcagcgctgtttccgt
ggcaaccatcgaatttcttcatcactgtgtgatccgaaggatccctttgcacagaatatg
gagatttctaacctttacatctatgacacggtgcttctgcttgcgaatgccttccataag
aagctggaggaccgtaagtggcacagcatggcaagcttgtcctgtatcaggaaaaactcc
aagccctggcaaggagggcggtccatgctggagaccatcaagaagggtggagttaatgga
ttgactggagatctagaatttggagaaaatggaggtaaccccaatgtccactttgaaatc
cttggaaccaactatggagaagaacttggcaggggtgtccgtaaacttgggtgctggaat
cctgtcacaggtctgaatggatcactgacagacaaaaaactggagaacaacatgcggggc
gtggttctacgagtggtgactgtattggaggagccttttgtaatggtctctgaaaatgtc
ttgggaaaaccgaagaaataccagggcttctccattgatgttttggatgccctatctaac
tacctgggttttaattatgaaatttatgttgcaccggaccacaaatatggaagcccacaa
gaggatgggacatggaatggactggtaggagaacttgtttttaagagagctgacattggg
atttcagctttaaccatcactccagaccgggagaatgttgtagattttacaacacgctac
atggactactcagtgggagtccttcttcgaagggcagaaaaaacagtggatatgtttgcc
tgccttgcaccatttgatctatctctgtgggcctgcattgctggcacagtgcttcttgtg
ggactcttggtctacctcttaaactggcttaatcccccacgattgcaaatgggatcgatg
acatctactacactctacaactccatgtggtttgtgtatgggtcctttgtacagcaaggt
ggggaagtcccatacacaactctggcaacccgaatgatgatgggggcttggtggttattt
gctctgattgtcatctcatcttatacagccaaccttgccgctttcctcactatcacccgc
attgagagctccatccagtctcttcaggatctgtccaagcaaacagatatcccttatggc
acagtcttggactcggcagtatatcagcatgtccgcatgaaggggctgaatcctttcgag
agagacagcatgtattcccagatgtggaggatgatcaaccgaagcaatgggtcagaaaac
aatgttttggagtcccaagcaggcattcaaaaggtaaaatatggaaactatgcttttgta
tgggatgcagctgtgttggaatatgtggctattaacgaccccgactgttccttctacact
gttgggaacactgttgctgaccgggggtatggcattgcactgcagcatggcagcccctac
cgtgatgtcttttcacaaaggatcctggagctgcagcagagtggcgacatggacattctc
aagcacaaatggtggcctaagaacggccagtgtgacctgtactcctcagtggatgcaaag
cagaagggaggagccttggacatcaagagcctggcaggcgtgttctgcatcctggccgcg
ggaattgtgctctcctgcctcatagctgtcctcgagacgtggtggagccggaggaagggc
tcccgggtcccatcgaaagaggatgacaaggaaattgacctggagcacctccatagacgt
gtaaatagcttgtgcacagatgacgacagcccccataaacagttttccacctcgtcaatt
gacttgacccctctggacattgacactttgccaacacgccaagccctggagcagatcagt
gatttcagaaacactcacatcaccaccaccaccttcatcccagagcagatccagactctt
agccgcacactctcagcaaaagctgcctctggcttcgctttcggcagtgtgcctgagcac
cgaactggcccttttaggcacagggctcctaatgggggctttttcaggagtcctatcaaa
acaatgtcatctattccttatcagcctactcccactctggggctcaatctgggcaatgac
cccgaccgaggcacgtccatatga

DBGET integrated database retrieval system