KEGG   Mus musculus (mouse): 14811Help
Entry
14811             CDS       T01002                                 

Gene name
Grin2a, GluN2A, NMDAR2A, NR2A
Definition
(RefSeq) glutamate receptor, ionotropic, NMDA2A (epsilon 1)
  KO
K05209  glutamate receptor ionotropic, NMDA 2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu04728  Dopaminergic synapse
mmu05010  Alzheimer's disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05033  Nicotine addiction
mmu05034  Alcoholism
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14811 (Grin2a)
   04015 Rap1 signaling pathway
    14811 (Grin2a)
   04020 Calcium signaling pathway
    14811 (Grin2a)
   04024 cAMP signaling pathway
    14811 (Grin2a)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14811 (Grin2a)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    14811 (Grin2a)
   04728 Dopaminergic synapse
    14811 (Grin2a)
   04720 Long-term potentiation
    14811 (Grin2a)
  Environmental adaptation
   04713 Circadian entrainment
    14811 (Grin2a)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    14811 (Grin2a)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    14811 (Grin2a)
   05014 Amyotrophic lateral sclerosis (ALS)
    14811 (Grin2a)
  Substance dependence
   05030 Cocaine addiction
    14811 (Grin2a)
   05031 Amphetamine addiction
    14811 (Grin2a)
   05033 Nicotine addiction
    14811 (Grin2a)
   05034 Alcoholism
    14811 (Grin2a)
Ion channels [BR:mmu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   14811 (Grin2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Motif
Other DBs
NCBI-GeneID: 14811
NCBI-ProteinID: NP_032196
MGI: 95820
Ensembl: ENSMUSG00000059003
Vega: OTTMUSG00000016264
UniProt: P35436
Position
16 A1; 16 5.28 cM
AA seq 1464 aa AA seqDB search
MGRLGYWTLLVLPALLVWHGPAQNAAAEKGTPALNIAVLLGHSHDVTERELRNLWGPEQA
TGLPLDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQT
FIPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGY
RDFISFIKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILT
TAASSMLEKFSYIPEAKASCYGQTEKPETPLHTLHQFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRS
NGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFT
IGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVD
QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQRGVEDALVSL
KTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALL
QFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRS
AKNISNMSNMNSSRMDSPKRAADFIQRGSLIVDMVSDKGNLIYSDNRSFQGKDSIFGENM
NELQTFVANRHKDSLSNYVFQGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMES
LRQDSLNQNPVSQRDEKTAENRTHSLKSPRYLPEEVAHSDISETSSRATCHREPDNNKNH
KTKDNFKRSMASKYPKDCSEVERTYVKTKASSPRDKIYTIDGEKEPSFHLDPPQFIENIV
LPENVDFPDTYQDHNENFRKGDSTLPMNRNPLHNEDGLPNNDQYKLYAKHFTLKDKGSPH
SEGSDRYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
ATREEAYQQDWSQNNALQFQKNKLKINRQHSYDNILDKPREIDLSRPSRSISLKDRERLL
EGNLYGSLFSVPSSKLLGNKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHTYGDDQRLVIG
RCPSDPYKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNNMYS
TPRVLNSCSNRRVYKKMPSIESDV
NT seq 4395 nt NT seq  +upstreamnt  +downstreamnt
atgggcagactgggctactggaccttgctggtattgccggcccttctggtctggcacggt
ccggcgcagaacgcggcggcggagaagggtactccagcgctgaacattgcggtgctgctg
ggtcacagccacgacgtgacagaacgcgaacttcgaaatctgtggggcccggagcaggca
accggcttgcccctggatgtgaacgtggtggcgttattgatgaaccgcactgaccctaag
agcctcatcacgcatgtgtgcgacctcatgtccggggcgcgcatccatggcttggtgttt
ggagatgatacggaccaagaggctgtggctcagatgctggattttatctcctcacagact
ttcatccccatcttgggcattcatgggggtgcatctatgatcatggctgacaaggatccg
acatccacgttcttccagtttggagcttccatccagcagcaagccacggtcatgctgaag
atcatgcaggactatgactggcatgtcttctccttggtcaccaccatcttccctggctac
agagacttcatcagcttcatcaagacaacagtggacaacagctttgtgggctgggatatg
cagaacgtgatcacactggacacctcttttgaggacgccaagacacaggtccagctgaag
aagatccactcctctgtcatcctgctctactgctccaaggatgaggctgtcctcatcctg
agcgaggctcgctctcttggcctcaccggctacgatttcttctggattgtccccagtttg
gtctccgggaacacagagctcatccccaaagagtttccatcgggtctcatttcagtctct
tacgacgactgggactacagtctggaggcaagagtgagagacggtcttgggatcttaacc
actgccgcatcttccatgttggagaaattctcctacattcccgaggccaaggccagctgc
tacgggcagacagagaagccggagaccccgctacacactctgcaccaatttatggtcaat
gtgacttgggatggcaaggacttgtccttcactgaggaaggctatcaggtgcaccccagg
cttgtggtgatcgtgctgaataaggaccgggaatgggaaaaggtgggcaagtgggagaat
cagactctgagcctgcggcatgctgtgtggccaaggtataagtccttttctgactgtgag
ccagatgacaaccacctcagcattgtcaccttggaggaagcccccttcgtcatcgtagaa
gacatagacccactgactgagacctgcgtcaggaacacggtaccctgtcggaagtttgtc
aagatcaacaattcaaccaacgaagggatgaatgtgaagaagtgctgcaaggggttctgc
atcgacatccttaagaaactgtccagaactgtaaagttcacctatgacctctacctggtg
accaatgggaagcatgggaaaaaggttaacaatgtgtggaatggaatgataggcgaagtg
gtctatcaacgagcagttatggccgtgggctccctcaccatcaatgaggagcgttcagaa
gtggtggacttctccgtgccctttgtggagacaggaatcagtgtcatggtctccaggagt
aatggcactgtttccccttctgctttccttgaacccttcagcgcctctgtctgggtgatg
atgttcgtgatgctgctcattgtctctgccattgctgtcttcgtttttgaatacttcagt
cctgttggatacaacagaaacttagccaaagggaaagctccccatgggccttcttttacc
attggaaaagctatatggctcctctggggcctggtcttcaacaattctgtgcccgtccag
aatcctaaaggcacaaccagcaagataatggtatcagtgtgggccttctttgccgtcatc
ttccttgcaagttacacagccaacctggctgccttcatgatccaggaggagtttgtggac
caagtgactggcctcagtgacaagaagttccagagacctcatgactattctccgcctttc
cgatttgggacagtacccaatggaagtacagaaaggaatattcgtaacaactacccctat
atgcaccagtacatgaccaaattcaaccagaggggcgtagaggatgccttggtcagcttg
aaaactgggaagttggacgctttcatctatgacgcagctgtcttgaactacaaggccggg
agggatgaaggctgtaaactggtgaccattgggagcgggtacatctttgccaccacaggc
tatggaattgctctgcagaagggctcaccctggaagaggcagattgacctcgctctgctc
cagtttgttggtgacggtgagatggaagagctggagacactgtggcttacgggcatctgc
cacaacgagaagaatgaggtgatgagcagccagctggacatcgacaacatggcaggagtt
ttctacatgctggctgcagctatggccctcagcctcatcaccttcatctgggagcacctc
ttctactggaagctgcgcttctgcttcacaggcgtgtgttctgaccggcccgggctgctc
ttctccatcagcaggggcatctacagttgcatccatggagtgcacattgaagaaaagaag
aagtctccagacttcaatctgactgggtcacagagcaacatgctaaagcttctccgctca
gctaaaaacatctccaacatgtccaacatgaactcctcgcgaatggactcacccaaaaga
gctgctgacttcatccaaagaggctcacttattgtggacatggtttcagacaagggaaat
ttgatatactcagataacaggtcctttcaagggaaggacagtatatttggagaaaacatg
aatgaactgcaaacatttgtggccaacaggcacaaggatagtctcagtaactatgtgttt
cagggacagcatcctctcactctcaatgagtccaaccccaacacagtggaggtggctgtc
agcactgaatccaaagggaactcccgaccccggcagctttggaagaaatccatggagtct
ctacgccaggattctctaaaccagaacccagtctcccagagggatgagaagactgcagag
aataggacccactccctaaagagtcctaggtatcttccagaagaggtagcccattctgac
atttctgaaacctcaagccgggccacatgccacagggagccagataataataagaaccac
aagaccaaggataacttcaaaaggtcaatggcctctaaataccccaaggactgtagtgag
gttgaacgtacctacgtgaaaaccaaagcaagttctcccagggataagatctacaccatc
gatggtgagaaggagcccagcttccacttagatcctccacagttcattgaaaacatagtc
ttgcctgagaatgtggacttcccagatacctaccaagatcacaatgagaatttccgcaag
ggggactccacactgcccatgaacaggaacccactacacaatgaagatgggcttcccaac
aatgaccagtataaactctatgccaagcactttaccttgaaagacaagggttccccacat
agtgagggcagtgatcgatatcggcagaactccacgcattgcagaagctgcctctcaaac
ctgcccacctactcaggccactttaccatgagatctcctttcaagtgtgatgcctgtctg
cggatggggaacctctatgacattgatgaagaccagatgcttcaggagacaggcaaccca
gctactcgtgaggaggcctaccagcaggactggtcacagaacaacgccctccagttccag
aagaacaagctaaagattaatcgacagcactcctatgataacattctcgacaaacccagg
gagatagaccttagcaggccctctcgtagcataagcctcaaggacagggaaaggctactg
gagggcaacttatacgggagcctgttcagtgtcccctcaagcaaactcttggggaacaaa
agctcccttttcccccaaggtctggaggacagcaagaggagcaaatctctcttgccagac
catacctctgataatcctttcctccacacgtacggggatgaccaacgcttagttattggg
agatgtccctcggacccttacaaacactcattgccatcacaggcagtaaatgacagctat
cttcggtcatccttgaggtcaacagcatcatattgctccagggacagtcggggccacagt
gatgtgtatatttcagagcatgttatgccttatgctgcaaataagaataacatgtactct
acccccagggttttaaattcctgcagcaatagacgtgtgtacaagaaaatgcctagtatt
gaatctgatgtctaa

DBGET integrated database retrieval system