KEGG   Mus musculus (mouse): 14812Help
Entry
14812             CDS       T01002                                 

Gene name
Grin2b, AW490526, GluN2B, NR2B, Nmdar2b
Definition
(RefSeq) glutamate receptor, ionotropic, NMDA2B (epsilon 2)
  KO
K05210  
glutamate receptor ionotropic, NMDA 2B
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14812 (Grin2b)
   04015 Rap1 signaling pathway
    14812 (Grin2b)
   04024 cAMP signaling pathway
    14812 (Grin2b)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14812 (Grin2b)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    14812 (Grin2b)
   04728 Dopaminergic synapse
    14812 (Grin2b)
   04720 Long-term potentiation
    14812 (Grin2b)
  Environmental adaptation
   04713 Circadian entrainment
    14812 (Grin2b)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    14812 (Grin2b)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    14812 (Grin2b)
   05014 Amyotrophic lateral sclerosis (ALS)
    14812 (Grin2b)
   05016 Huntington's disease
    14812 (Grin2b)
  Substance dependence
   05030 Cocaine addiction
    14812 (Grin2b)
   05031 Amphetamine addiction
    14812 (Grin2b)
   05033 Nicotine addiction
    14812 (Grin2b)
   05034 Alcoholism
    14812 (Grin2b)
Ion channels [BR:mmu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   14812 (Grin2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 G1; 6 66.38 cM
AA seq 1482 aa AA seqDB search
MKPSAECCSPKFWLVLAVLAVSGSKARSQKSAPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAI
LQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEH
LFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILR
LLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFS
DYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSISK
KPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKR
RKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTK
ENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHLKHGTGDKHGVVGGVPAPWEKN
LTNVDWEDRSGGNFCRSCPSKLHNYSSTVAGQNSGRQACIRCEACKKAGNLYDISEDNSL
QELDQPAAPVAVSSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPR
SVSLKDKGRFMDGSPYAHMFEMPAGESSFANKSSVTTAGHHHNNPGSGYMLSKSLYPDRV
TQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKTRPDFRALVTNKPVVSALHGAVPGRF
QKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
NT seq 4449 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccagcgcagagtgctgttctcccaagttctggttggtgttggccgtcttggcc
gtatcgggcagcaaagctcgttcccaaaagagcgcccccagcatcggcatcgctgtcatc
ctcgtgggcacttccgacgaagtggccataaaagatgcccacgagaaagatgacttccat
catctctcagtagttccccgggtggagctggtagccatgaacgagactgacccaaagagc
ataatcacccgcatctgcgatcttatgtctgaccggaagatccagggggtggtgttcgcg
gatgacacggaccaggaagccatcgcccagatcctcgatttcatttctgctcagactctc
acccccatcctgggcatccatgggggctcatctatgataatggcagataaggatgagtcc
tccatgttcttccagtttggcccatccattgaacagcaagcttctgtcatgctcaacatc
atggaagaatacgactggtacatcttctccatcgtcaccacctacttccccggctaccag
gacttcgtgaacaagatccgcagcactattgagaacagctttgtgggctgggagctcgag
gaagtcctcctgctagacatgtctctagacgatggcgactctaagatccagaatcagctg
aagaagctgcagagccccatcattctcctctactgcacaaaggaagaagccacctacatc
ttcgaagtagctaactcagttgggctgactggctacggctacacatggatcgtgccgagt
ctggtggcgggggatacggacacggtgccttcagagttccccacggggctcatctctgtg
tcatatgacgaatgggactatggccttcctgccagagtgagagatgggattgccatcatc
accactgctgcctcggacatgctgtccgaacacagtttcatccctgagcccaagagcagt
tgctacaacacccacgagaagaggatctaccagtctaacatgctgaataggtatctgatc
aacgtcacttttgaagggagaaacctgtccttcagtgaagatggctaccagatgcatccg
aagctggtgataatccttctgaacaaggagaggaagtgggagagggtgggaaaatggaaa
gacaagtccctgcagatgaaatactatgtgtggcctcgaatgtgtcctgagactgaagaa
caggaagatgaccatctgagcatcgttaccttggaggaggcaccgtttgtcattgtggaa
agtgtggaccctctcagtgggacctgcatgcggaatacagtcccgtgccagaagcgcatc
atctctgagaataaaacagatgaggaaccaggctacatcaaaaaatgctgcaaggggttt
tgtattgatatccttaagaaaatttctaagtctgtgaagttcacctatgacctttacctg
gtgaccaatggcaagcatggaaagaaaatcaacgggacctggaacggcatgattggtgag
gtggtcatgaagagggcctatatggcagtgggatcactaactatcaatgaagaacggtca
gaggtggttgacttctctgtgcccttcatagagactggcatcagtgtcatggtatcacgc
agcaatgggactgtgtcaccttctgccttcttagagccattcagtgctgacgtgtgggtg
atgatgtttgtgatgctgctcattgtctctgctgtagctgtctttgtctttgaatacttc
agccctgtgggttacaaccggtgcctagctgatggcagagagccaggcggcccatctttc
accatcggcaaagcgatttggttactctggggtctggtgtttaacaactccgtacctgtg
cagaacccaaaggggaccacctccaagatcatggtgtcagtgtgggccttctttgctgtc
attttcctggccagctacactgccaacttagccgccttcatgatccaagaggagtatgtg
gaccaggtttccggcctgagtgacaagaagttccagagacctaatgacttctcaccccct
ttccgctttgggactgtgcccaatggcagcacagagaggaatatccgtaataactatgca
gaaatgcatgcctacatgggaaagttcaaccaaaggggtgtagatgatgccttgctctcc
ctgaaaacagggaaacttgatgcattcatctacgatgcagccgtgctcaactacatggct
ggaagagacgaaggctgcaagctggtgaccattggcagtggcaaggtctttgcttctacg
ggctatggcattgctatccaaaaagactctggttggaaacgccaggtggaccttgctatc
ctgcagctgtttggagatggggagatggaagaactggaagctctctggctcactggcatt
tgccacaatgagaagaatgaggttatgagcagccagctggacattgacaacatggcgggc
gtcttctatatgttgggggcagccatggctctcagcctcatcaccttcatctgtgaacat
ctcttctattggcagttccgacattgcttcatgggtgtctgttctggcaagcctggcatg
gtcttctccatcagcagaggtatctacagctgtatccacggagtagctatagaggagcgc
caatccgtgatgaactcccccactgccaccatgaacaacacacactccaatatcctacgc
ttgctccgaacggccaaaaacatggccaacctgtctggagtcaacggctccccccagagt
gccctggacttcatccgccgtgagtcctctgtctatgacatctctgagcatcgccgcagc
ttcacgcattcagactgcaagtcgtacaataacccaccctgtgaggaaaacctgttcagt
gactacattagtgaggtagagagaacatttggcaacctgcagctgaaggacagcaatgtg
taccaagaccactatcaccatcaccaccggccccacagcatcggcagcaccagctccatt
gatgggctctatgactgtgacaacccaccctttaccacccagcccaggtcaatcagcaag
aaacccctggacattggcctgccctcctccaaacacagccagctcagcgacctgtacggc
aagttctctttcaagagtgaccgctacagtggccatgatgacttgattcgatcagatgtc
tcagacatctccacgcatactgtcacctatggcaacatcgagggcaacgcagccaagagg
aggaagcagcaatataaggacagtctaaagaagcggccagcctcggccaaatctaggagg
gagtttgatgaaatcgagctggcctaccgtcgccgaccaccccgctccccagaccacaag
cgctacttcagggacaaagaagggctccgagacttctacctggaccagttccgaacaaag
gagaactcgcctcactgggagcacgtggacttgactgacatttacaaagaacgtagtgat
gacttcaagcgagattcggtcagtggaggcgggccctgtaccaacaggtctcaccttaaa
cacggaacaggcgataagcacggagtggtaggcggggtgcctgctccttgggagaagaac
ctgaccaatgtggattgggaggataggtctgggggcaacttctgccgcagctgtccctcc
aagctgcacaattactcctctacggtggcagggcaaaactcgggccggcaggcctgcatc
aggtgtgaggcctgcaagaaggctggcaacctgtatgacatcagcgaggacaactccctg
caggaactggaccagcctgctgcccctgtggctgtgtcatccaacgcctccaccaccaag
tatcctcaaagcccgactaattccaaggcccagaagaagaatcggaacaaactgcgccgg
cagcactcctacgacaccttcgtggacctgcagaaggaggaggccgccttggccccacgc
agcgtgagcctgaaagacaagggccgattcatggatgggagcccctacgcccatatgttt
gagatgccagctggtgagagctcctttgccaacaagtcctcagtgaccactgccggacac
catcacaacaatcccggcagcggctacatgctcagcaagtcgctctaccctgaccgggtc
acgcaaaaccctttcatccccacttttggggatgatcagtgcttgcttcacggcagcaaa
tcctacttcttcaggcagcccacggtggcaggggcgtcgaaaacaaggccggacttccgg
gcccttgtcaccaataagccagtggtgtcagcccttcatggggctgtgccaggtcgtttc
cagaaggacatttgtatagggaaccagtccaacccctgtgtgcctaacaacaaaaacccc
agggctttcaatggctccagcaatggacatgtttatgagaaactttctagtattgagtct
gatgtctga

DBGET integrated database retrieval system