KEGG   Mus musculus (mouse): 14814Help
Entry
14814             CDS       T01002                                 

Gene name
Grin2d, GluN2D, NMDAR2D, NR2D
Definition
(RefSeq) glutamate receptor, ionotropic, NMDA2D (epsilon 4)
  KO
K05212  
glutamate receptor ionotropic, NMDA 2D
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    14814 (Grin2d)
   04024 cAMP signaling pathway
    14814 (Grin2d)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14814 (Grin2d)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    14814 (Grin2d)
   04720 Long-term potentiation
    14814 (Grin2d)
  Environmental adaptation
   04713 Circadian entrainment
    14814 (Grin2d)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    14814 (Grin2d)
   05014 Amyotrophic lateral sclerosis (ALS)
    14814 (Grin2d)
  Substance dependence
   05030 Cocaine addiction
    14814 (Grin2d)
   05031 Amphetamine addiction
    14814 (Grin2d)
   05033 Nicotine addiction
    14814 (Grin2d)
   05034 Alcoholism
    14814 (Grin2d)
Ion channels [BR:mmu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   14814 (Grin2d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 B4; 7 29.54 cM
AA seq 1323 aa AA seqDB search
MRGAGGPRGPRGPAKMLLLLALACASPFPEEVPGPGAAGGGTGGARPLNVALVFSGPAYA
AEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDDSRA
PAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEYD
WTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLGAQLRSVSAQI
RLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVGPQLAGGGGSGVPGEPLLLPGGAPLPAG
LFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESLHRY
FMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFL
QPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRC
CKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTIN
EERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFI
FEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWA
FFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNIR
SNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKV
FATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLDID
NMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEAAP
PPAKPPPPPQPLPSPAYPAARPPPGPAPFVPRERAAADRWRRAKGTGPPGGAALADGFHR
YYGPIEPQGLGLGEARAAPRGAAGRPLSPPTTQPPQKPPPSYFAIVREQEPAEPPAGAFP
GFPSPPAPPAAAAAAVGPPLCRLAFEDESPPAPSRWPRSDPESQPLLGGGAGGPSAGAPT
APPPRRAAPPPCAYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYPYAERLGPPPGR
YWSVDKLGGWRAGSWDYLPPRGGPAWHCRHCASLELLPPPRHLSCSHDGLDGGWWAPPPP
PWAAGPPPRRRARCGCPRPHPHRPRASHRAPAAAPHHHRHRRAAGGWDLPPPAPTSRSLE
DLSSCPRAAPTRRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDLGTRRGSAHFSSLE
SEV
NT seq 3972 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcgccggtggcccccgcggccctcggggccccgctaagatgctgttgctgctg
gcgctggcgtgcgccagcccgttcccggaggaggtgccggggccgggcgcggccggcggg
ggcacgggcggggcgcggccgctcaacgtggcgctggtcttctctggcccggcgtacgcg
gccgaggcggcgcgcttgggcccggccgtggcggcggcagtgcgcagcccgggcctggac
gtacggcccgtggcgctggtgctcaacggctccgaccctcgcagccttgtgctgcagctc
tgcgacctgctgtcggggctgcgcgtgcacggcgtggtgttcgaggacgactcgcgcgcg
cccgccgtcgcgcccattctcgacttcctgtcggcgcagacctcgctgcccatcgtggcc
gtgcacggcggcgccgcgctcgtactcacacccaaggagaagggctccaccttcctgcag
cttggctcctccacagagcaacagctgcaggtcatttttgaggtgctggaggagtacgac
tggacatcctttgtggcagtgactacgcgtgccccaggccatcgagccttcttgtcatac
atcgaggtgctgactgatggcagcctggtgggctgggagcatcgaggagcgctgacactg
gaccccggagcgggtgaggccgtcctgggcgcacagctccgtagtgtcagtgcgcagatc
cgcctgctcttctgcgcccgcgaggaggcagagcctgttttccgggcggcagaagaggct
ggtctcactgggcctggctacgtctggttcatggtgggacctcagctggccggaggtggg
ggctccggggtccctggggaaccacttcttctgccaggaggtgccccactgcctgctggg
ctgtttgcagtgcgctctgctggctggcgtgacgacttggcacgtcgagtggctgctggt
gtggcggtggtggccagaggtgcccaggccctgctgcgagactatggcttcctgcctgag
ctgggccatgactgtcgcgcccagaatcgcacccaccgcggggagagtctgcacaggtat
ttcatgaacatcacctgggataaccgagactactccttcaatgaggatggctttctggta
aacccgtcactggtagtcatctccctcaccagagacaggacgtgggaagtggtgggcagc
tgggaacagcagaccctccgcctcaagtaccctctatggtcccgctatggccgcttcctg
cagccggtggatgacacgcagcacctcactgtggccacgctggaggagagaccttttgtc
attgtagagcctgcagaccccatcagcggcacttgcatcagagactcggttccctgccgg
agccagctcaaccgtacccacagccctccgcctgacgctccccgcccggagaagagatgc
tgcaagggtttctgcattgacattttgaagaggctggcgcacaccatcggtttcagctat
gacctctacctggttaccaacggcaagcatggcaagaagatcgatggcgtctggaatggc
atgattggtgaggtgttctatcagcgtgcggacatggccatcggctccctcaccatcaat
gaggagcggtcagagatcgtggacttctccgtcccttttgtagagacaggcatcagcgtc
atggtggcacgcagcaatggcactgtgtccccctctgccttcctcgagccctacagcccc
gctgtgtgggtgatgatgttcgtcatgtgcctcaccgtggtcgccgtcacagttttcatc
tttgagtacctcagtcctgtgggctataaccgaagcctggccacgggcaaacgccccgga
ggctctaccttcaccattgggaaatccatctggctgctgtgggccctggtgttcaacaac
tccgtgccagtggagaatcctcggggcaccaccagcaagatcatggtgctggtgtgggcc
ttctttgccgtcatctttcttgccagctatacagccaatctggctgccttcatgatccag
gaggagtacgtggacaccgtgtctgggctcagcgaccggaagttccagcggccccaggag
caatacccacccctgaagtttggaacggtgcccaatgggtccacggagaagaatatccga
agcaactaccctgatatgcacagctacatggtgcgatacaaccagccaagagtggaggag
gcgctcactcagctcaaggcagggaaactggacgccttcatctatgacgcagcagtgctc
aactacatggcccgaaaggatgagggctgcaagctggtcaccatcggctcaggcaaggtc
ttcgccaccactggttatggcatcgccctacacaagggctcccgctggaagaggcccatc
gacctggcgctgctgcagttcctgggggacgatgagattgagatgctggagcggctgtgg
ctttcagggatctgccacaacgacaaaatcgaggtgatgagcagcaagctggatatcgac
aacatggcaggtgtcttctacatgctcctcgtggccatgggcctctccttgctggtcttc
gcctgggaacaccttgtgtactggcgactgcggcactgtctggggcccacccaccgcatg
gatttcctactggccttctccaggggtatgtacagctgctgcagcgctgaggctgctccg
ccgccggccaaacccccgccaccgccgcagccgctgcccagtccggcgtatcccgccgct
cgcccaccccctggccccgcacccttcgtgccccgagagcgcgcagccgccgaccgctgg
cgccgggccaagggcacagggcccccggggggcgcagcgctagccgacggcttccaccga
tactacggccccatcgagccgcaggggctgggcctcggcgaggcgcgcgcggcaccgaga
ggcgcagccggacgcccactgtccccacccaccacacagcccccacagaagccaccacct
tcctacttcgccatcgtgcgcgagcaagagccggccgagccccccgccggcgccttcccg
ggcttcccatctccgcccgctccgcctgccgccgcagccgccgccgtcgggccgccactg
tgccgcctggctttcgaggacgagagcccgcccgcgccctcgcgctggccgcgttctgac
cccgagagccagccgctgttgggtgggggcgcgggcggcccgagcgctggggccccgacc
gcaccaccgccgcgccgcgccgcgccaccaccgtgcgcctacctggacctcgagccttcg
ccttcggactccgaggattcggagagcctgggcggagcgtcgctcggtggcctggagccc
tggtggttcgccgacttcccctacccgtatgcggagcgcctcgggccgccgcccggccgc
tactggtcggttgacaagctcgggggctggcgcgctggtagctgggactacctgcccccg
cgcggcggccccgcatggcactgccgccactgcgccagcctggagctgctaccgccacca
cgccatctcagctgctcgcacgacggcctagacggtggctggtgggcgcctccgcctcca
ccctgggctgcggggccaccgccccggcgccgggcgcgctgtggttgtccgcgaccgcac
ccgcaccgcccccgggcttcgcaccgtgcgcccgccgccgcaccgcaccaccaccgacac
aggcgcgcggcgggtggctgggacctcccgccgcccgcgcccacctcgcgttcgctggag
gacctgagctcctgcccacgggcggcccccacgcgcaggctcaccgggccctcgcgccac
gcgcgccgctgtccgcacgctgcgcattgggggccgcccctgcccaccgcatctcaccgg
agacaccggggcggggacctgggcacacgcaggggctctgcgcacttctccagcctggag
tccgaggtatga

DBGET integrated database retrieval system