KEGG   Mus musculus (mouse): 14823Help
Entry
14823             CDS       T01002                                 

Gene name
Grm8, A230002O04, Gprc1h, mGluR8
Definition
(RefSeq) glutamate receptor, metabotropic 8
  KO
K04608  
metabotropic glutamate receptor 6/7/8
Organism
mmu  Mus musculus (mouse)
Pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    14823 (Grm8)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14823 (Grm8)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    14823 (Grm8)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     14823 (Grm8)
G protein-coupled receptors [BR:mmu04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    14823 (Grm8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 A3
AA seq 908 aa AA seqDB search
MVCEGKRSTSCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRLDGDIILGGLFPVHAKGER
GVPCGDLKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KELCPGYIGLCPRMVTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQINN
KSTEYKIIGHWTNQLHLKVEDMQWANREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNINRTGCQRIPIIKLEWHSPWAVVPVFIAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
TIIDYGEQRTLDPENARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggtttgtgagggaaagcgctcaacctcttgcccttgtttcttccttttgactgccaag
ttctactggatcctcacaatgatgcaaagaactcacagccaggagtatgcgcattccatc
cgcctggatggggacatcattttggggggtctttttcctgttcatgccaagggagaaaga
ggggtgccttgtggggacctgaagaaggaaaagggcatccacagacttgaggccatgctt
tatgcaatcgaccagattaataaggaccccgatctcctctccaatatcactctgggtgtc
cggatccttgacacatgttccagggacacctatgctttggagcagtcactaaccttcgtg
caggcactgatagagaaagacgcgtctgacgtgaagtgtgctaatggagacccacccata
ttcaccaagcccgacaagatttctggtgtcataggtgctgcagcaagctccgtgtccatc
atggtggctaacattttaagactttttaagatacctcagattagctatgcatctacagcc
ccagagctaagtgacaacaccaggtatgatttcttttctcgggtggtcccgcctgactcc
taccaagcccaagccatggtggacattgtgacagccctgggatggaattatgtgtcaaca
ctggcttccgaggggaactatggagagagtggtgttgaggccttcactcagatctcaagg
gagattggtggtgtttgcattgctcaatcacagaaaatcccacgtgaaccaagacctgga
gaattcgaaaaaattatcaaacgcctgctggagacacccaacgctcgcgcagtgattatg
tttgccaatgaggatgacatcaggaggatattggaagcagcaaaaaaattaaaccagagt
gggcattttctatggattggctcagatagttggggatccaaaatagcacctgtctatcag
caggaggagatcgccgaaggagctgtgacaattttgcccaaaagagcatcaattgatggg
tttgaccgatactttagaagccgaactcttgccaataatcgaagaaatgtgtggtttgca
gaattttgggaggagaattttggatgcaaattaggatcacatgggaagaggaacagtcat
ataaagaaatgcacagggctggagcgaattgcacgggattcatcttacgaacaagaagga
aaggttcaatttgtaattgatgcagtgtattccatggcttatgcactgcacaacatgcac
aaagaactctgccctggttacataggcctttgcccaaggatggttaccatcgatgggaaa
gagctactgggttacatcagggccgtgaattttaatggcagcgctggtacacctgtcact
tttaatgagaatggagatgctccgggacgctacgatatcttccaatatcagataaacaac
aaaagtacagaatacaaaatcatcggccactggaccaatcaacttcacctaaaagtggaa
gacatgcagtgggctaatagagagcacacgcacccagcatctgtctgcagcctgccgtgc
aagcctggggagaggaagaaaaccgtgaaaggggtcccttgctgctggcactgtgaacgc
tgcgagggttataactaccaggtggacgaactctcctgtgaactctgccctttggatcag
agaccaaacatcaaccgcactggctgccagaggattcccatcatcaagttggagtggcat
tcaccctgggccgtggtacctgtgttcatagcaatattgggaatcattgccaccaccttt
gtgattgtgacctttgtccgctataatgacacaccaatcgtgagagcttctgggcgggaa
cttagttatgtgctcctaacggggatttttctctgttactcaatcacttttttgatgatt
gcggcacctgacacaatcatctgctctttccgaaggatcttcctgggacttggtatgtgt
ttcagctatgcagcacttttgaccaaaacaaaccgtatccaccgaatattcgagcaaggg
aagaaatctgtcacagcacctaagttcatcagcccagcatcccagctggtgatcaccttc
agcctcatctccgtacagctccttggagtgtttgtgtggtttgtcgtggatcccccccac
accatcattgactatggagaacagcgaacactggatcccgagaacgccaggggagtgctc
aagtgtgacatttccgatctgtcactcatttgttcactgggatacagtatcctcctgatg
gtcacttgtactgtttatgccattaaaaccagaggggttccagaaacgttcaatgaagcc
aaacctattggatttaccatgtacaccacgtgcatcatttggttagctttcattcccatc
ttttttggtacagcccagtcagcagaaaagatgtacatccagacaacaacacttactgtc
tccatgagtttaagtgcttcagtgtctctgggaatgctctatatgcccaaagtttatatt
ataatttttcatccagagcagaacgttcaaaaacgcaagagaagcttcaaggctgtggtc
acggccgctaccatgcaaagcaaactgatccaaaagggaaatgacagaccaaacggcgag
gtgaaaagtgaactctgtgagagtcttgaaaccaacacttcttctaccaagacaacatac
atcagctacagtaatcattcaatctga

DBGET integrated database retrieval system