KEGG   Mus musculus (mouse): 14827Help
Entry
14827             CDS       T01002                                 

Gene name
Pdia3, 58kDa, ERp57, ERp60, ERp61, Erp, Grp58, PDI, PDI-Q2, PI-PLC, PLC[a], Plca
Definition
protein disulfide isomerase associated 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    14827 (Pdia3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    14827 (Pdia3)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     14827 (Pdia3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   14827 (Pdia3)
  Exosomal proteins of colorectal cancer cells
   14827 (Pdia3)
  Exosomal proteins of bladder cancer cells
   14827 (Pdia3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 E5; 2 60.38 cM
AA seq 505 aa AA seqDB search
MRFSCLALLPGVALLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRD
NYRFAHTNIESLVKEYDDNGEGITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSI
FGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKTFSHELSDFGLESTTGEVPVVAIRTAKGEKFVMQEEFSRDGKALEQFLQEYFDGN
LKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYL
QREATNPPIIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcagctgcctagctctgctcccgggcgtggcgctgctgctcgcctcggcccgt
ctcgccgccgcctccgatgtgttggaactgacggacgaaaacttcgagagtcgcgtctcc
gacacgggctcggcggggctcatgctagtcgagttcttcgccccctggtgtggacattgc
aagaggcttgcccctgagtatgaagctgcagcaaccagattaaaaggaatagtcccatta
gcaaaggtggattgcactgccaacacaaacacctgtaataagtatggggtcagtggctac
ccaactcttaagatctttagagatggtgaagaagcgggtgcttatgatgggcctaggact
gctgatggaattgtcagccacttgaagaaacaagcaggaccagcttcagttcctctcagg
actgaggaagaatttaagaagttcattagtgataaagatgcctcagtggtgggttttttc
agggatttattcagtgatgggcactctgaattcctaaaagcagccagcaacttgagagat
aactaccgatttgcacacaccaacattgagtctctggtgaaggagtacgatgataatgga
gaggggatcactatattccgtccattacatcttgctaacaagtttgaagacaaaactgtg
gcatatactgaaaagaaaatgaccagtggcaagatcaagaaatttattcaggatagcatt
tttggtctctgtcctcatatgacggaagataataaagatttgatacaaggcaaggactta
ctcaccgcttactatgatgtggactatgaaaagaatgctaaaggttctaactactggaga
aacagggtcatgatggtggcaaagaaattccttgatgctggacacaaactcaactttgct
gtagctagccgtaaaacctttagccatgaactgtcagattttggcttagaaagcactact
ggagaggttcctgttgtggctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcgcgagatggcaaggctcttgaacagttcctgcaagaatactttgatggcaac
ttgaagagatacctgaagtctgaacccatcccagagtccaacgaagggcctgtcaaggtt
gtggtagcagagaattttgatgacatagtgaatgaagaagataaggacgtgctgattgaa
ttttacgccccttggtgtggccactgtaagaatctggaacccaagtataaagagctggga
gaaaaactcagcaaagatccaaatattgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcaagggttttcctaccatctacttctcaccagccaacaag
aagctaactccaaagaagtatgaaggtggccgtgaattaaatgattttattagctatcta
caacgagaagctacaaacccccctataattcaagaagaaaaacctaagaagaagaagaag
gcacaagaggacctctaa

DBGET integrated database retrieval system