KEGG   Mus musculus (mouse): 14829Help
Entry
14829             CDS       T01002                                 

Gene name
Grpr, GRP-R
Definition
gastrin releasing peptide receptor
Orthology
K04169  
gastrin-releasing peptide receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mmu04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mmu04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X F5; X 75.63 cM
AA seq 384 aa AA seqDB search
MAPNNCSHLNLDVDPFLSCNDTFNQSLSPPKMDNWFHPGFIYVIPAVYGLIIVIGLIGNI
TLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFI
QLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFS
DLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLAIISVYYYFIARNLIQ
SAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSML
HFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLMNRSHSTGRSTTCMT
SFKSTNPSATFSLINRNICHEGYV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaataattgttcccacctgaacttggacgtggaccctttcctgtcctgcaac
gacaccttcaatcaaagtctgagtccccccaagatggacaactggtttcacccgggcttc
atctatgtcatccctgcagtttatgggcttatcatcgtgataggtcttattggcaacatc
acgctcatcaagatcttctgcacggtcaagtccatgcgaaacgtgccaaacctgttcatc
tctagcctggctttgggagacctgctgctgctggtgacatgcgcccctgtggatgccagc
aagtacctggctgacaggtggctatttggcagaattggctgcaaactgatcccctttata
caacttacttcagtgggggtgtctgtcttcacacttacggcactgtcagctgacaggtac
aaagccattgtacggccaatggatatccaggcatcccatgccctgatgaagatctgtctc
aaagctgctttgatctggattgtctctatgttgttggccatcccagaggctgtgttttct
gacctccaccccttccatgtgaaagataccaaccaaaccttcattagttgtgccccctac
ccacactccaatgagctacaccctaaaatccattccatggcttcctttctggttttctac
gttatcccactggcgatcatctctgtctactactacttcattgcccgaaatctgattcag
agtgcctacaatcttcccgtggaaggcaatatacatgtcaagaagcagatcgaatcccgg
aagcggcttgccaagacagtactggtgtttgtgggcctctttgccttctgctggctcccc
aaccatgtcatctacctgtaccgttcctaccactactctgaagtggacacctccatgctc
cactttgtcaccagcatctgtgcccgcctcctggccttcaccaactcctgtgtgaacccc
tttgctctttatctgctgagcaagagcttcaggaagcagttcaacactcaacttctctgc
tgccagcctggcctgatgaacaggtcccacagcacaggcagaagtaccacctgcatgacc
tccttcaagagcactaacccctcggctacctttagcctcatcaacagaaatatctgtcat
gaggggtatgtctag

DBGET integrated database retrieval system