KEGG   Mus musculus (mouse): 14841Help
Entry
14841             CDS       T01002                                 

Gene name
Haspin, Gsg2
Definition
(RefSeq) histone H3 associated protein kinase
  KO
K16315  
serine/threonine-protein kinase haspin [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     14841 (Haspin)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  Haspin family
   14841 (Haspin)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    14841 (Haspin)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B4; 11 45.25 cM
AA seq 754 aa AA seqDB search
MAQAHPRSGTRLFRTYAARGVRGSQRQPGGLAEQWFQPPNLKRAFSSSLSDSNESPAVAS
DDPDDPDFPGSLVGQRRRRPRGSGSRNQRTLTNTPRVQRLRPRLPQKCSTPCSRLRPPPF
PNCSPGCLGSDHSVCIQSRDSNELGTSASLFSSPASPGAPDPLYADSAVPGSFHLPAASL
SEPSVPCPQVAATGDRYTGRALRAEASFRSSLFSLVNSGATEENKFGTDGENVKESCCER
RQQMGNRLTDPDLTSPGKRKAACKKVVSQGVDQRDYEESSACKDLRVPGEISRPKRTGPL
RKRKQQEATGTPPRHYHQSKKKRKASVSLWNLNTSQRDSWTKTRASFGFHKKKIITSVIE
VCSSVASSSSRSLLSECSTPPIKNRAHLTVSSRCSSVYLLSPLKTLHVTDQRPSYAEKVY
GECNQEGPIPFSDCLSTEKLERCEKIGEGVFGEVFQIINDQAPVALKIIAIEGLDLVNGS
HQKTFEEILPEIIISKELSLLSSEAYNRTEGFIGLNSVHCVQGLYPPLLLKAWDHYNTTK
RSANDRPDFFQEDQLFIILEFEFGGVDLERMKTKLSSVATAKSILHQITASLAVAEASLH
FEHRDLHWGNVLLKKTNLKELRYTLNGKTSTIPTHGLQVNIIDYTLSRLERDGIVVFCDI
SAEEDLFTGEGDYQFEIYRLMRKENKNCWGEYHPYNNVLWLHYLTDKILNKMKFKTKCQS
AAMKQIRKNLQHFHRTVLSFSSATDLLCQHSLFR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggctcacccgcggtcgggtacccggctctttcgaacgtacgcggcgaggggc
gtccgggggtcgcagcggcagcctggcgggctggctgagcaatggttccagccgccgaac
ctgaagcgcgccttcagcagcagcctcagcgacagtaacgagtcgccggctgtcgcttcc
gacgacccggacgaccccgacttccccggcagcctcgtgggccagcggcggaggcgtcct
cggggcagcggctcccggaaccagcggaccctgacaaacactccaagagtccaaaggctg
cgacctcggctcccgcagaagtgcagcaccccgtgcagccggctgcgaccgccacctttc
cccaactgcagcccgggctgcctcgggtcggaccacagtgtgtgcatccagtccagggac
agcaacgagctgggcaccagtgcctccctcttcagctctccggcctcgcccggagccccc
gaccctttgtatgctgactctgcagtccccgggagcttccacttgccggcagcctcccta
agtgaaccgtctgtgccctgcccccaggtggcagcaaccggtgacaggtacaccgggagg
gccctccgagccgaagccagcttcaggtcatctctctttagccttgtgaactcaggggcc
acagaagagaacaagtttgggacagatggggagaatgtgaaggaatcgtgttgtgaaaga
agacagcagatgggaaacagactaacggaccctgatctgacaagcccgggaaagagaaag
gccgcgtgtaaaaaggttgtgtcccaaggagtcgaccagagagactatgaggagtccagt
gcttgcaaagaccttcgtgtaccaggggaaatcagcaggcctaagagaactgggccactc
cggaagaggaaacagcaagaagcaacgggaacccctccccgccactaccaccaatctaag
aagaaaaggaaagcgtcagtctccttatggaacttgaatactagccagagggattcttgg
accaaaaccagagcctccttcggtttccacaagaagaaaattataaccagtgtgatagag
gtatgcagttctgttgccagttcttcctccaggtccctcctgtctgaatgttcgacccct
cctatcaagaacagagcacaccttactgtttcttctcgatgctcttctgtgtatttgcta
agtcccttaaagaccctgcatgtcacagaccaaaggccatcttatgctgaaaaggtttat
ggggagtgtaatcaggaagggcccatcccctttagtgattgcctttccacggaaaaactg
gaacggtgtgagaagattggggaaggagtgtttggagaagtgtttcagataattaacgac
caagcacctgtagccctaaaaatcattgctattgaagggttagatttagtcaatgggtcc
caccagaaaacctttgaggaaatcctgccggagatcattatctccaaagagctgagtctc
ttgtctagtgaggcctacaaccgcacagaaggctttattgggctgaactcagtacactgt
gttcaagggctttaccctcccttgctgctgaaagcctgggatcactataacacaaccaaa
agatctgccaatgaccggcctgactttttccaggaagaccagctctttattatcctggaa
tttgagtttggtggggttgacttggagcgaatgaaaaccaagctgtcctctgtggcgact
gcaaagagcattctccaccagatcactgcatctctggctgtggcagaagcatccctgcac
tttgagcaccgggacttacactggggaaatgtgctcttaaagaaaaccaacctcaaagaa
ctccgctacaccctcaatgggaaaacgagcaccattcccacccatgggctacaggtcaac
atcattgactacaccctgtcccgcttggagcgggatgggattgtggttttctgtgatatc
tccgctgaagaggacctatttacaggtgagggtgactaccagtttgagatctacaggctc
atgaggaaggagaacaaaaactgctggggtgagtatcacccttacaataatgtgctgtgg
ctgcattacctcacagacaagattctgaataagatgaaatttaagactaaatgccagagc
gcagccatgaagcaaataaggaaaaacctgcaacatttccacaggactgtactgagtttc
agctctgccacggacctgctctgccaacacagtctatttaggtaa

DBGET integrated database retrieval system