KEGG   Mus musculus (mouse): 14860Help
Entry
14860             CDS       T01002                                 

Gene name
Gsta4, GST5.7, mGsta4
Definition
(RefSeq) glutathione S-transferase, alpha 4
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    14860 (Gsta4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14860 (Gsta4)
   00982 Drug metabolism - cytochrome P450
    14860 (Gsta4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    14860 (Gsta4)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    14860 (Gsta4)
  Drug resistance
   01524 Platinum drug resistance
    14860 (Gsta4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14860 (Gsta4)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14860 (Gsta4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9; 9 E1
AA seq 222 aa AA seqDB search
MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEI
DGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEES
YDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPL
LQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaacctaagctctactactttaatggcaggggacggatggagtcgatccgc
tggctgctggctgcggctggagtggagtttgaggaagaatttcttgagacaagggaacag
tatgagaagatgcaaaaggatggacacctgcttttcggccaagtacccttggttgaaatc
gatgggatgatgctgacacagaccagggccatcctcagctacctcgctgccaagtacaac
ttgtatgggaaggacctgaaggagagagtcaggattgacatgtatgcagatggcacccag
gacctgatgatgatgattgccgtggctccatttaaaacccccaaggaaaaagaggagagc
tatgatttgatactgtcaagagctaaaacccgttacttcccagtgtttgaaaagatttta
aaagaccacggagaggcttttctcgttggcaaccagctcagttgggcagacatccagctc
ctagaagccattttgatggtggaagaactcagtgcccctgtactgtccgacttccctctg
ctgcaggcatttaagacaagaatcagcaacattcctacaattaagaagttcctgcaaccc
ggaagtcagaggaagcctcctccagatggcccctatgttgaggtggtcaggactgtcctg
aagttctag

DBGET integrated database retrieval system