KEGG   Mus musculus (mouse): 14860Help
Entry
14860             CDS       T01002                                 

Gene name
Gsta4, GST5.7, mGsta4
Definition
glutathione S-transferase, alpha 4 (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    14860 (Gsta4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14860 (Gsta4)
   00982 Drug metabolism - cytochrome P450
    14860 (Gsta4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    14860 (Gsta4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14860 (Gsta4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 E1; 9
AA seq 222 aa AA seqDB search
MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEI
DGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEES
YDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPL
LQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaacctaagctctactactttaatggcaggggacggatggagtcgatccgc
tggctgctggctgcggctggagtggagtttgaggaagaatttcttgagacaagggaacag
tatgagaagatgcaaaaggatggacacctgcttttcggccaagtacccttggttgaaatc
gatgggatgatgctgacacagaccagggccatcctcagctacctcgctgccaagtacaac
ttgtatgggaaggacctgaaggagagagtcaggattgacatgtatgcagatggcacccag
gacctgatgatgatgattgccgtggctccatttaaaacccccaaggaaaaagaggagagc
tatgatttgatactgtcaagagctaaaacccgttacttcccagtgtttgaaaagatttta
aaagaccacggagaggcttttctcgttggcaaccagctcagttgggcagacatccagctc
ctagaagccattttgatggtggaagaactcagtgcccctgtactgtccgacttccctctg
ctgcaggcatttaagacaagaatcagcaacattcctacaattaagaagttcctgcaaccc
ggaagtcagaggaagcctcctccagatggcccctatgttgaggtggtcaggactgtcctg
aagttctag

DBGET integrated database retrieval system