KEGG   Mus musculus (mouse): 14860Help
Entry
14860             CDS       T01002                                 

Gene name
Gsta4, GST5.7, mGsta4
Definition
glutathione S-transferase, alpha 4 (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mmu00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mmu00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mmu00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mmu05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 E1; 9
AA seq 222 aa AA seqDB search
MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEI
DGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEES
YDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPL
LQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaacctaagctctactactttaatggcaggggacggatggagtcgatccgc
tggctgctggctgcggctggagtggagtttgaggaagaatttcttgagacaagggaacag
tatgagaagatgcaaaaggatggacacctgcttttcggccaagtacccttggttgaaatc
gatgggatgatgctgacacagaccagggccatcctcagctacctcgctgccaagtacaac
ttgtatgggaaggacctgaaggagagagtcaggattgacatgtatgcagatggcacccag
gacctgatgatgatgattgccgtggctccatttaaaacccccaaggaaaaagaggagagc
tatgatttgatactgtcaagagctaaaacccgttacttcccagtgtttgaaaagatttta
aaagaccacggagaggcttttctcgttggcaaccagctcagttgggcagacatccagctc
ctagaagccattttgatggtggaagaactcagtgcccctgtactgtccgacttccctctg
ctgcaggcatttaagacaagaatcagcaacattcctacaattaagaagttcctgcaaccc
ggaagtcagaggaagcctcctccagatggcccctatgttgaggtggtcaggactgtcctg
aagttctag

DBGET integrated database retrieval system