KEGG   Mus musculus (mouse): 14872Help
Entry
14872             CDS       T01002                                 

Gene name
Gstt2, AI266894, Yrs, mGSTT2
Definition
(RefSeq) glutathione S-transferase, theta 2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    14872 (Gstt2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14872 (Gstt2)
   00982 Drug metabolism - cytochrome P450
    14872 (Gstt2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14872 (Gstt2)
   05204 Chemical carcinogenesis
    14872 (Gstt2)
   05225 Hepatocellular carcinoma
    14872 (Gstt2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    14872 (Gstt2)
  Drug resistance
   01524 Platinum drug resistance
    14872 (Gstt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14872 (Gstt2)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14872 (Gstt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
UniProt: 
Position
10 C1; 10 38.58 cM
AA seq 244 aa AA seqDB search
MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDG
SFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLG
PLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALG
YNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKKMLPVPPPEVHASMQLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcttggagctctacctggacctgctgtcacaacccagccgcgctgtctacatcttc
gccaagaagaatggcatccccttccagacgcgtaccgtggatatactcaaagggcagcac
atgagcgagcaattctcccaggtgaactgcttaaacaaagttcctgtactcaaagacgga
agcttcgtgttgaccgaaagcacagccatcttgatttacctgagttccaagtaccaggtg
gcagaccactggtacccggccgacctacaggcccgtgcccaagtccacgaatacctgggc
tggcatgccgacaacatccgtggtactttcggagtgctcctatggaccaaggtgttgggg
ccactcattggggtccaggttccccaggagaaggtggaacggaacagagatagaatggtc
ctggttctgcaacagctggaggacaagttcctcagggacagggccttccttgttggccag
caggtgacgctagcggatctcatgtctctggaggagttgatgcagcccgtggctcttggc
tataacctgtttgagggacggcctcagctgacagcatggcgagagagggtggaggcgttc
ttgggtgctgagctgtgtcaggaggctcatagcaccatcctgagcatcctgggacaggca
gccaagaaaatgttaccagtaccccctccggaggtccatgccagcatgcagcttcgaatt
gctaggattccttga

DBGET integrated database retrieval system