KEGG   Mus musculus (mouse): 14885Help
Entry
14885             CDS       T01002                                 

Gene name
Gtf2h4, AW545633, BTF2_p52, TFIIH, p44, p52
Definition
general transcription factor II H, polypeptide 4
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mmu03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mmu03420]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mmu05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17
AA seq 463 aa AA seqDB search
MEITPARGGLNRAHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRM
LFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPVFRQNLR
IALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLL
SQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQ
LSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGG
TVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGI
TAQQIIHFLRTRAHPVMLKQNPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFE
LLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagatcaccccggcgaggggtggactgaaccgagcacacctacaatgcaggaatctc
caggagttcttaggaggcctgagccctggggtgctggaccgattgtatgggcaccctgcc
acttgtctggctgtcttcagggagctcccctctttggctaagaactgggtcatgaggatg
ctctttctggagcagccgctaccacaggctgcggtggccctgtgggtgaagaaggagttc
agcaaggctcaggaggaaagtacggggctgctgagtggcctccgtatctggcatacccag
ctgctccctggtggactccaaggcctcatcttgaaccccgtcttccgccagaacctccga
attgcccttctgggtgggggcaaggcctggtctgatgacacaagtcagctgggaccagac
aagcatgcccgggacgtcccctcactggacaagtatgctgaggagcgctgggaggtggtc
ttgcacttcatggtgggctcccccagtgcagctgtcagccaagacctggctcagctcctc
agccaggccgggcttatgaaaagcactgaacctggagagccaccctgcatcacttccgct
ggcttccagttcctgctactggacacgcctgcccagctctggtacttcatgctgcagtat
ctgcagacagcccagagccggggcatggatctggtggagattctctccttccttttccag
ctcagcttctccactcttggcaaggactactctgtggaggggatgagtgactctttgttg
aacttcctgcaacacctgcgtgagttcgggcttgttttccagaggaagaggaagtcccgg
cgttactaccccacacgcctggccatcaacctctcatctggtgtctctggggctgggggc
actgtgcaccagccaggcttcattgtcgtggaaactaattaccgactgtacgcctatacc
gagtcggaactgcagatcgctctcattgcccttttctccgaaatgctctatcgattcccc
aacatggtggtggcacaagtgacccgggagagtgtgcagcaggccattgctagtggcatc
acagctcagcagataatccatttcctaaggacaagggcacatccagtgatgctcaaacag
aatcctgtgctgccccccaccataacagaccagattcggctgtgggagctggaaagggac
agactccggttcactgaaggcgtcctgtataaccagttcctgtcgcaagtggactttgaa
ctgctgctggcccacgcgcgggagctgggcgtgcttgtgttcgagaactcggccaagcgg
ctgatggtggtgacgccggcagggcacagcgacgtcaagcgcttctggaagcggcagaag
cacagctcctga

DBGET integrated database retrieval system