KEGG   Mus musculus (mouse): 14885Help
Entry
14885             CDS       T01002                                 

Gene name
Gtf2h4, AW545633, BTF2_p52, TFIIH, p44, p52
Definition
general transcription factor II H, polypeptide 4
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    14885 (Gtf2h4)
  Replication and repair
   03420 Nucleotide excision repair
    14885 (Gtf2h4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    14885 (Gtf2h4)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     14885 (Gtf2h4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17
AA seq 463 aa AA seqDB search
MEITPARGGLNRAHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRM
LFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPVFRQNLR
IALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLL
SQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQ
LSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGG
TVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGI
TAQQIIHFLRTRAHPVMLKQNPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFE
LLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagatcaccccggcgaggggtggactgaaccgagcacacctacaatgcaggaatctc
caggagttcttaggaggcctgagccctggggtgctggaccgattgtatgggcaccctgcc
acttgtctggctgtcttcagggagctcccctctttggctaagaactgggtcatgaggatg
ctctttctggagcagccgctaccacaggctgcggtggccctgtgggtgaagaaggagttc
agcaaggctcaggaggaaagtacggggctgctgagtggcctccgtatctggcatacccag
ctgctccctggtggactccaaggcctcatcttgaaccccgtcttccgccagaacctccga
attgcccttctgggtgggggcaaggcctggtctgatgacacaagtcagctgggaccagac
aagcatgcccgggacgtcccctcactggacaagtatgctgaggagcgctgggaggtggtc
ttgcacttcatggtgggctcccccagtgcagctgtcagccaagacctggctcagctcctc
agccaggccgggcttatgaaaagcactgaacctggagagccaccctgcatcacttccgct
ggcttccagttcctgctactggacacgcctgcccagctctggtacttcatgctgcagtat
ctgcagacagcccagagccggggcatggatctggtggagattctctccttccttttccag
ctcagcttctccactcttggcaaggactactctgtggaggggatgagtgactctttgttg
aacttcctgcaacacctgcgtgagttcgggcttgttttccagaggaagaggaagtcccgg
cgttactaccccacacgcctggccatcaacctctcatctggtgtctctggggctgggggc
actgtgcaccagccaggcttcattgtcgtggaaactaattaccgactgtacgcctatacc
gagtcggaactgcagatcgctctcattgcccttttctccgaaatgctctatcgattcccc
aacatggtggtggcacaagtgacccgggagagtgtgcagcaggccattgctagtggcatc
acagctcagcagataatccatttcctaaggacaagggcacatccagtgatgctcaaacag
aatcctgtgctgccccccaccataacagaccagattcggctgtgggagctggaaagggac
agactccggttcactgaaggcgtcctgtataaccagttcctgtcgcaagtggactttgaa
ctgctgctggcccacgcgcgggagctgggcgtgcttgtgttcgagaactcggccaagcgg
ctgatggtggtgacgccggcagggcacagcgacgtcaagcgcttctggaagcggcagaag
cacagctcctga

DBGET integrated database retrieval system