KEGG   Mus musculus (mouse): 14919Help
Entry
14919             CDS       T01002                                 

Gene name
Gucy2e, GC-E, GC1, ROS-GC1
Definition
(RefSeq) guanylate cyclase 2e
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu04740  Olfactory transduction
mmu04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    14919 (Gucy2e)
 Organismal Systems
  Sensory system
   04744 Phototransduction
    14919 (Gucy2e)
   04740 Olfactory transduction
    14919 (Gucy2e)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     14919 (Gucy2e)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   14919 (Gucy2e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 14919
NCBI-ProteinID: NP_032218
MGI: 105123
Ensembl: ENSMUSG00000020890
Vega: OTTMUSG00000005963
UniProt: P52785
Position
11 B3; 11 42.51 cM
AA seq 1108 aa AA seqDB search
MSAWLLPAGGLPGAGFCVPARQSPSSFSRVLRWPRPGLPGLLLLLLLPSPSALSAVFKVG
VLGPWACDPIFARARPDLAARLAANRLNRDFALDGGPRFEVALLPEPCLTPGSLGAVSSA
LSRVSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRAAGTTAPAVTPAADALYVLLR
AFRWARVALITAPQDLWVEAGRALSTALRARGLPVALVTSMETSDRSGAREALGRIRDGP
RVRVVIMVMHSVLLGGEEQRYLLEAAEELALTDGSLVFLPFDTLHYALSPGPEALAAFVN
SSQLRRAHDAVLTLTRRCPPGGSVQDSLRRAQEHQELPLDLNLKQVSPLFGTIYDAVFLL
AGGVKRARTAVGGGWVSGASVARQVREAQVSGFCGVLGRTEEPSFVLLDTDASGEQLFAT
HLLDPVLGSLRSAGTPMHFPRGGPAPGPDPSCWFDPDVICNGGVEPGLVFVGFLLVIGMG
LTGAFLAHYLRHRLLHMQMASGPNKIILTLEDVTFLHPPGGSSRKVVQGSRSSLATRSAS
DIRSVPSQPQESTNVGLYEGDWVWLKKFPGEHHMAIRPATKTAFSKLRELRHENVALYLG
LFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQREIKLDWMFKSSLLLDLIKGMRYL
HHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLPEPPSAEDQLWTAPELLRDP
SLERRGTLAGDVFSLAIIMQEVVCRSTPYAMLELTPEEVIQRVRSPPPLCRPLVSMDQAP
MECIQLMTQCWAEHPELRPSMDLTFDLFKSINKGRKTNIIDSMLRMLEQYSSNLEDLIRE
RTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSE
PIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDIL
SAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYR
IHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGRLGFNKPIPKPPDLQPGAS
NHGISLQEIPPERRKKLEKARPGQFTGK
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttggctcctgccagccggagggcttcccggcgccgggttctgtgtccctgcg
cggcagtctccgtccagtttctcgcgggtcctgcgctggccaaggcctgggctaccggga
ctcctgctactgctactgctcccatctccttctgccctctctgctgtgttcaaagtgggg
gtgctgggcccctgggcttgcgaccccatctttgcacgggcccgaccagacctggctgcg
cgtctggccgccaaccgcctgaatcgtgactttgctttagacggcggcccccggttcgag
gttgcgctgctcccagagccctgcctgactccgggctcactaggggctgtgtcctctgcg
ctgtctcgagtctctggcctggtgggtccggtgaaccccgcagcctgtcggccagccgaa
ctgttggctcaagaagctggagtagcgctggtgccctggggctgccctggcacgcgggcg
gcgggtactacagccccggcggtgacccccgctgcagatgctctctacgtcctccttaga
gcattccgctgggcgcgcgtggccctgatcactgcaccccaagacctgtgggtggaggcg
ggacgcgctctgtccacagcactcagggcccggggtttgccagttgccctagtgacttcc
atggagacttcagaccggtctggagcccgggaggccctcgggaggatccgagatgggcct
agagttagagtagtgatcatggtgatgcactcggtgctgctgggcggcgaggagcagcgc
tacctactggaagctgcagaagaactggctctgactgatggctccctggttttcctgccc
ttcgacacgcttcactacgctttgtctccaggcccggaggctctggctgcatttgtcaac
agctcccagctccgcagggctcacgatgcggtgctcacactcacgcgccgctgtcctcct
ggaggcagcgtgcaagacagcctgcgcagggctcaagaacaccaggaactgccccttgac
ctcaacctgaagcaggtctctccgctgtttggcaccatctatgatgctgtcttcctgttg
gctgggggcgtgaagagagcaagaacagcggtgggtggtggctgggtgtcaggtgcatct
gtagcccgccaagtacgggaagcacaagtctctggcttttgtggggtcctgggaagaacc
gaggagccctcctttgtgctgctggacacagatgcatccggagaacagttgttcgcaaca
cacctgctagatcctgtcttaggctccctgcgttctgcagggacccccatgcacttccct
agaggtggacctgccccgggaccagacccttcctgctggttcgatccagatgtgatctgc
aacggaggggtggagccaggcctggtctttgttggcttcctcctggtgatagggatggga
ctgactggagccttcttggctcattacttgaggcacaggctgctacacatgcagatggct
tccggccccaacaagatcatcttgacgttggaagatgttactttcctccacccaccggga
ggcagctctcgaaaggtggtccagggaagtagatccagtctggctacccggagcgcatca
gacattcgcagtgtccccagccagccccaagagagcaccaacgttggcctctatgagggg
gactgggtttggctgaagaagttcccaggggaacatcatatggctatcaggccagcaaca
aagacagccttctccaagcttcgagagctccggcatgagaatgtggctctctacttggga
ctcttcctggcgggtacagcagacagccctgccacccctggggagggcatcttggctgtg
gtctcagagcactgtgctcggggttccctccatgacctcctggcccagagagaaataaag
ctggactggatgttcaagtcttccctcctgctggacctcatcaagggaatgagatatctg
caccatcgcggtgtggcccacgggaggctcaagtcacggaattgcgtggtggacgggagg
ttcgtgctcaaggtgacagatcatggccatgggcgactgctggaagcgcaaagggtgtta
ccggaacctcccagtgcagaggatcagctatggacagccccagagcttcttcgggacccc
tccctggagcgccggggaactctagctggtgatgtctttagtctggccatcatcatgcag
gaggtcgtgtgccgcagcaccccttatgccatgctggaactaacgcccgaggaagtaata
cagagggtgcggagccctcctccactgtgtcggcccttggtgtccatggaccaggcaccc
atggagtgcatccagctgatgacacaatgctgggcagagcatccagaacttcggccttcc
atggacctcacctttgacctgttcaagagcatcaacaagggccggaagaccaacatcatc
gactccatgcttcggatgctggagcagtactctagtaacctggaggatctgatccgagaa
cgcacagaggagttagagcaggagaagcagaagacagacaggctgctcacacagatgctg
cctccatctgtggctgaggccctgaagatggggacatctgtggagcctgagtactttgaa
gaggtgacactctacttcagtgacatcgtgggctttaccaccatttcagccatgagcgag
cctattgaggtggtagacctgcttaatgacctctatactctcttcgatgccatcatcggt
gcccatgatgtctataaggtggaaacaattggagatgcatatatggtggcctccgggctg
ccgcagaggaacgggcagcggcacgctgcagagattgccaacatgtcactggacatcctc
agtgcagtcggctccttccgcatgcgccatatgcccgaggtaccggtgcgcatccgcatt
ggtttgcactcaggcccgtgcgtggcgggtgtggtgggcctcaccatgcctcggtactgc
ctgttcggggacacggtcaacactgcctcgagaatggagtccactggactgccttaccgc
atccacgttaacatgagcactgttcggattcttcgcgctctggaccaaggcttccagatg
gagtgtcgaggccgcacggagctgaagggcaagggtattgaggacacgtactggcttgtg
ggcagacttggcttcaacaagcccattcccaaaccacctgatctgcagccaggggccagc
aaccatggtatcagcctgcaggagattcccccagagagacgcaagaagctggagaaagcc
aggccaggccagtttactgggaagtga

DBGET integrated database retrieval system