KEGG   Mus musculus (mouse): 14923Help
Entry
14923             CDS       T01002                                 

Gene name
Guk1, AA409738, AL033299, AL033300, AV026611, Gmk, Guk-1
Definition
guanylate kinase 1 (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mmu00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11 B1.3; 11
AA seq 207 aa AA seqDB search
MEAATHQVGMAGPRPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGK
DYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIK
KTDLCPIYIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIIN
DDLDKAYATLKQALSEEIKKAQGTGHA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgcaacacatcaagtaggcatggcaggacctaggccagtagtgctgagcggg
ccgtcaggggcagggaagagcactctgctcaagaagctgttccaggagcacagcagcatc
ttcggcttcagcgtgtctcatactacaaggaacccacgacctggtgaagaagatggcaaa
gattactactttgtgaccagggagatgatgcagcgtgatattgcagcaggggacttcatt
gagcatgctgagttctcagggaacctgtacgggacaagcaaggaagctgttcgggctgtg
caggccatgaaccgcatctgcgtgctagatgtcgacctacaaggtgtgcgcagcatcaag
aagactgatctgtgtcccatctacatctttgtgcagcctccctcgctggacgtgctggag
caacgactgcgactgcgcaacactgagactgaggagagtctggcaaagcggctggcagct
gcacggacagacatggagagcagcaaggagcctggcttgtttgacctggtgatcatcaat
gacgacctggataaagcctatgcaaccctgaagcaggcgctctctgaggaaatcaagaaa
gcacagggaactggccacgcctga

DBGET integrated database retrieval system