KEGG   Mus musculus (mouse): 14924Help
Entry
14924             CDS       T01002                                 

Gene name
Magi1, AIP3, BAP1, Baiap1, Gukmi1, MAGI1c, Magi-1, TNRC19, WWP3, mKIAA4129
Definition
(RefSeq) membrane associated guanylate kinase, WW and PDZ domain containing 1
  KO
K05631  
atrophin-1 interacting protein 3 (BAI1-associated protein 1)
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    14924 (Magi1)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    14924 (Magi1)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Others
   JAM4, JCAM; junctional adhesion molecule 4 [KO:K06786]
    14924 (Magi1)
   ESAM; endothelial cell adhesion molecule [KO:K06787]
    14924 (Magi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6; 6 D3
AA seq 1471 aa AA seqDB search
MSKVIQKKNHWTGRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAAEAAGLPGGGE
GPKLAEGELLLEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRF
QKGSPDHELQQTIRDNLYRHAVPCTTRSPREGEVPGVDYSFLTVKEFLDLEQSGTLLEVG
TYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHPENEE
EEDVPEMNSSFTADSGDQDEHTLQEATLPPVNSSILAAPITDPSQKFPQYLPLSAEDNLG
PLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELE
LPAGWEKIEDPVYGVYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQPQPPQPEEWTED
HASVVPPVAPSHPPSNPEPARETPLQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVG
GDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASV
DLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTGKVSSMKDA
RPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRV
KQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDMLIECPKGSEVTLLVQRGGLPVPK
KSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHGIQVLPEYLPADAPAPDQTDSSGQKK
PDPFKIWAQSRSMYENRPMSPSPASGLSKGERDREINSTNFGECQIPDYQEQDIFLWRKE
TGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLM
QQAAKQGHVNLTVRRKVVFAVPKAENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNT
VSSGSGSTSGIGSGGGGGSGVVSAVLQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFGR
IIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNAT
LLTNAEKIATITTTHAPSQQGTQETRTTTKPKQDSQFEFKGPQAAQEQDFYTVELERGAK
GFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEILEINGETTKNMKHSRAIELIK
NGGRRVRLFLRRGDGSVPEYDPSSDRNGPSTGAQGVPEVRPGPPDHRPHPALESSYPPEL
HKSSQHAEKRAHAKDPKGNREHSKQPNEHHTWNGTSRKQDSGACRPKDRPPDAWREAQPE
RTATNGSKRRSPEKRREGTRSADNTLERREKHEKRREISPERKRERSPTRRKDSSPSRRR
RSLERLLDQRRSPERRRGGSPERRAKSTDRRRARSPERRRERSLDKRNRDDKVGHREREE
AGLKLEAGRSPRNPPEQRRRPYKECSTDLSI
NT seq 4416 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagtgatccagaagaagaaccactggactggccgcgttcacgagtgcaccgtg
aagcggggaccccagggcgagctgggggtgacggtcctggggggcgcggagcatggggag
tttccgtacgtgggggcggtggcggcggccgaggcggcggggcttcccggcggtggcgag
gggccgaagctggccgaaggtgagctgctgctggaggtgcagggggtccgggtgtccggc
ttgccccgctatgacgtgctgggagtcatcgacagctgcaaggaggccgtcaccttcaaa
gccgtcagacaaggaggaaggctcaacaaggacctacgacatttcctcaaccaacggttc
cagaaggggtctccagatcatgagctccagcagaccataagggacaacctctaccgccat
gctgtgccttgcacaacccggtctcccagagaaggagaagtgcctggtgtggattacagc
tttctgactgtgaaggagttcttggacctcgagcagagcgggaccctgttggaagtcggc
acctatgaaggaaactattatgggacacccaaacctcctagccagccagtcagtgggaaa
gtgatcacgacggatgccttgcacagcctgcagtctggctccaagcagtcgacccctaag
cgaacaaagtcctacaatgatatgcaaaatgctggcatagtccacccggagaatgaggag
gaggaggatgtccctgaaatgaacagtagctttacagccgactctggagaccaggacgag
cacactctccaagaagcaacgctcccgcctgtgaatagtagcatcctcgctgctcccatc
acggacccttctcagaagttccctcagtacctacctctttctgcagaggataatttaggt
cctctacctgaaaactgggagatggcctatactgaaaatggagaagtctatttcatagac
cacaacacgaaaacaacatcatggttagaccctcggtgcctgaacaaacagcagaagcct
ctggaagaatgtgaagatgatgaaggggtacacaccgaggagctggacagtgaactagag
ttgcctgctggctgggaaaagattgaagaccctgtctacggtgtctactatgtagaccac
atcaacaggaagacgcaatatgaaaacccagtcctagaagccaaacggaagaaacagctt
gaacagcagcagcaacagcagcagcctcagccaccgcagccagaagagtggacagaggat
catgcatctgttgtgcctcctgttgctccttcccatcccccgagcaatccggagccagcc
agggaaactccacttcagggcaaacctttttttacaagaaacccctctgagctgaaaggc
aagttcattcacacgaagctacggaaaagcagccgaggctttggcttcacggtggttgga
ggagacgagcctgatgagttcctgcagatcaagagcctcgtcctcgatggtcctgccgca
ctggatggcaagatggagacaggggatgtaattgtgagtgtgaatgacacctgtgttttg
ggacacacacatgctcaagttgtgaaaatcttccagtccattcccattggtgccagtgtg
gaccttgaactctgcagaggttatccattgccttttgacccggatgaccctaatacaagt
ttagtgacctcggtggccattttggacaaagaaccaattattgtaaatggacaagagacc
tacgattcaccagcgagccacagtagtaaaacaggcaaagtcagcagcatgaaggatgcc
aggccaagcagccctgctgatgtggcttccaacagctctcatggttatcccaacgacaca
gtctccttggcttcctccatagccacccagccagagctaataactgttcacatagtcaaa
gggccaatgggatttggctttacgatcgcagacagtcccggtgggggtggccaaagagtg
aaacagattgttgacagtccacgctgcagaggcctcaaagaaggggatcttatcgtggag
gtgaataagaagaacgtgcaggccctgacgcacaatcaagtcgtggatatgctgattgaa
tgtcccaagggaagtgaggtcacactgttggtgcagcgaggagggctaccagttcccaag
aagagcccaaagtcgcagccactggagaggaaagacagccagaatagctcccagcacagc
gtctccagccaccggagcctgcacactgcgtccccgagccacggcatacaggtgctccct
gagtacctacctgcagacgcccctgctccagatcagaccgacagctctgggcagaaaaag
ccagatccttttaaaatctgggcccagtccaggagcatgtatgaaaaccgacctatgtca
ccttcgcctgcatcaggattgagcaagggtgaaagagacagagaaatcaattccacgaat
tttggagaatgtcagattccagattaccaggaacaggacatcttcctctggagaaaagaa
accggatttggatttaggattctgggtggaaatgaaccaggggaacccatttatatcggt
cacatcgtaccgctgggtgctgctgacacagacggccgcctgaggtctggagatgaatta
atctgtgtggatgggacaccagtaattgggaaatcacaccagctcgtggtccagcttatg
caacaagctgccaagcaaggccatgtcaatctcacagtgaggcggaaagtggtctttgcc
gtccccaaagcagagaatgaggtgccctcaccagcctcatcacaccacagtagcaaccag
cccgcgtccctgacggaggagaaacgcacaccgcaaggcagccagaactctctgaacact
gtgagctctggcagcggcagcaccagtggcattggcagtggtggcggcgggggcagcggt
gtggtgagcgctgtgctgcagccctatgatgtggagattcggcgtggggagaacgagggc
tttgggtttgtcatcgtgtcctccgtgagcagacccgaagcgggcacaaccttcggtcgg
attattgaggggagccctgctgaccgctgtggcaagctgaaagtaggagaccggatcttg
gcagtaaatggatgttccatcaccaacaaatcccattctgacattgtcaacctaatcaaa
gaagcgggcaacacagtgactctccgcatcatccccggggatgagtcctcaaatgccacg
ctgctgactaatgctgagaagattgccaccatcaccaccactcatgccccctctcagcag
gggacccaggaaacaaggaccaccaccaaaccaaagcaggattctcagtttgagttcaaa
ggaccgcaggctgcacaggagcaagatttctacactgtggaattggaaagaggggccaag
ggatttggctttagtcttcgagggggccgagaatataacatggatctttatgttctgcgc
ttggcagaggatggtcctgcagaaagatgtgggaagatgaggattggcgatgaaattcta
gagatcaatggtgagaccaccaaaaacatgaaacactctcgggccatagaactgatcaag
aatggcggccgcagggtccgtctgtttctgcggcggggagacggctcagtcccagaatat
gaccccagcagcgacaggaacggcccctccaccggtgcacaaggtgttccggaagtgagg
ccggggccgccagaccacagaccgcatccagccttggagtccagttacccacccgaactt
cacaaatcatcacaacatgccgaaaagcgagcacacgcgaaggatccaaaaggcaacagg
gagcacagcaaacaacccaacgaacatcacacctggaatggaacttctagaaaacaggac
agcggggcatgccggcccaaagaccggccacccgacgcatggagagaggcgcagccagag
cggacagccaccaatggttcaaagaggaggtcaccggagaagcgcagggaaggcacccgc
agcgctgacaacactttggaaagaagggagaagcatgagaagagaagagagatatctccc
gagaggaagcgagagcgttcacccacccggagaaaagatagctccccgagccgccggcgg
aggtccctcgaaagactcctggatcaaagacggtccccagagcgcagaagagggggctcc
cccgagaggagagccaaatccaccgacaggaggagggccaggtcccctgagcgcaggcga
gagcggtcactggacaaaaggaaccgggacgacaaggttggccaccgagaaagagaggag
gctggtctgaagctggaagcggggagaagcccccgaaatcccccagagcagagaaggcgg
ccttacaaagaatgtagcaccgacctcagcatctga

DBGET integrated database retrieval system