KEGG   Mus musculus (mouse): 14933Help
Entry
14933             CDS       T01002                                 

Gene name
Gyk, D930012N15Rik, GK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    14933 (Gyk)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    14933 (Gyk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     14933 (Gyk)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   14933 (Gyk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X C-D; X 39.32 cM
AA seq 552 aa AA seqDB search
MAAAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKVTGEPLYNAVAAPVSPGS
SVPVAVVPSGSSVPAAGASSVWLDLRTQSTVENLSKRIPGNNNFVKSKTGLPLSTYFSAV
KLRWLLDNVKKVQEAVEENRALFGTIDSWLIWSLTGGIHGGVHCTDVTNASRTMLFNIHS
LEWDKELCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQD
GQAKNTYGTGCFLLCNTGHKCVFSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWL
RDNLGIIKSSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHI
AFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMP
ETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSIG
WVTTQSPESGIP
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgcgaagaaagcagttctggggccattggtgggagcagtggaccagggtacc
agctcgacacgttttttggttttcaattcaaaaacagctgaacttcttagtcatcatcaa
gtagaaataaaacaggaattcccaagagaaggatgggtagaacaagacccgaaggaaatt
ctgcagtctgtttatgagtgtatagagaaaacgtgtgagaaacttggacagctcaatatt
gatatttccaacatcaaagccattggtgtcagcaaccagagggaaaccacagtagtctgg
gacaaggtcaccggagagcctctctataatgccgtggctgctccagtttctcctggctct
tcagttccagttgccgttgtcccctctggctcttcagttccagctgctggtgcttcctca
gtgtggcttgacctaagaacccagtctactgttgagaaccttagtaaaagaattccagga
aataataactttgtcaagtccaagacaggccttccacttagcacgtatttcagtgcagtg
aaacttcgttggctccttgacaacgtgaaaaaggtccaagaggctgttgaagaaaataga
gctctttttgggaccattgattcatggcttatttggagtttaacaggaggaatccatggg
ggtgtccactgtacagatgtaacaaatgcaagcaggacgatgctttttaacattcattct
ttggaatgggataaagagctctgcgaattttttggaattccaatggaaattcttcccaac
gttcggagttcttctgagatctatggcctaatgaaagctggggccttggaaggtgtacca
atatctgggtgtttgggggaccagtctgctgctttggtgggacaaatgtgcttccaggat
ggacaggccaaaaacacgtatggaacagggtgcttcttattgtgcaacacgggccataag
tgtgtattttctgaacatggcctcctgacaaccgtagcatataaacttggcagagacaaa
cctgtgtattatgcgttggaaggttccgtggctatagctggtgctgtaatccgctggcta
agagacaaccttggaattattaagtcctctgaggaaattgaaaaacttgctaaggaagta
ggtacttcttatggctgctacttcgttccagcattttcagggttatatgcgccttattgg
gagcccagtgcaagagggatcatctgtggactcactcagttcaccaataaatgtcatatc
gcttttgctgcactagaagctgtttgtttccaaacccgagagattttggatgccatgaat
cgcgactgtggaattccactcagtcatttacaggtagatggaggaatgaccagcaataaa
attcttatgcagctacaagcagacattctgtatattccagtagtgaaaccctccatgcct
gaaacaactgcactaggcgctgccatggcagctggggctgcagagggggttggtgtgtgg
agtcttgaacctgaggatttgtcagctgtcacaatggagcggtttgaacctcagatcaat
gctgaagaaagcgaaatccgttactccacatggaagaaagctgtgatgaagtcaattggt
tgggttacaactcagtctccagaaagtggtatcccataa

DBGET integrated database retrieval system