KEGG   Mus musculus (mouse): 14936Help
Entry
14936             CDS       T01002                                 

Gene name
Gys1, Gys3, MGS
Definition
(RefSeq) glycogen synthase 1, muscle (EC:2.4.1.11)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    14936 (Gys1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    14936 (Gys1)
   04152 AMPK signaling pathway
    14936 (Gys1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    14936 (Gys1)
   04922 Glucagon signaling pathway
    14936 (Gys1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    14936 (Gys1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     14936 (Gys1)
Glycosyltransferases [BR:mmu01003]
 Polysaccharide
  Storage polysaccharide
   14936 (Gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 B4; 7 29.31 cM
AA seq 738 aa AA seqDB search
MPLSRSLSVSSLPGLEDWEDEFDPENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPYVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEVDATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPLGEDSERYDEEEEAAKDRRNIRAPEWPRRASCSSSTGGSKRSNSVDTGPSSSL
STPTEPLSPTSSLGEERN
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcagccgcagtctctctgtgtcctcgcttccaggattggaagactgggaggat
gaattcgaccccgagaacgcagtgcttttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacactgtgctgcagacgaaggcgaaggtgacaggggatgaatggggtgac
aactactatctggtgggaccatacacggagcagggtgtgaggacgcaggtagagctcctg
gagcccccaactccggaactgaagaggactttggattccatgaacagcaagggttgtaag
gtgtattttgggcgttggctgatcgaggggggacccctagtggtgctcctggatgtagga
gcctcagcttgggccctggagcgctggaagggtgagctttgggacacctgcaacatcggg
gtaccctggtacgaccgcgaggccaatgacgctgtcctgttcggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgaagagaagccgtatgtggttgcccacttccac
gaatggttggctggcgttggtctgtgtctgtgccgtgcccggcgcttgccggtggcaacc
atcttcaccactcatgccacgctgctggggcgctacctgtgtgctggcgctgtggacttc
tacaacaacctggagaatttcaatgtagacaaggaagcaggagagaggcagatctatcac
cggtactgcatggagcgtgcagcagctcactgtgcccatgtcttcactaccgtatcccag
atcaccgcaatcgaggctcaacacctccttaagagaaaaccagatattgtgacccccaac
gggctgaatgtgaagaagttctctgctatgcacgaattccagaaccttcatgctcagagc
aaagcacgaatccaggaatttgtgcgtggccatttttatgggcacctggacttcaaccta
gacaagactttgtatttctttatcgctggccgctatgagttttccaacaagggagctgat
gtgttcctggaggcattggcccggctcaactatctgctcagagtgaatggcagtgagcaa
acagttgtcgcattcttcatcatgccggcccggaccaataatttcaacgtggaaaccctg
aagggccaagccgtgcgcaaacaactatgggacacagccaatacagtcaaggagaaattt
gggaggaagctctacgaatcccttttagtggggagcctcccggacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccactcagcggcagtctttc
ccaccagtgtgcacccacaacatgctggacgactcctcagaccccatcttgaccaccatc
cgccgaattggccttttcaacagcagtgccgaccgtgtgaaggtgatttttcacccagaa
ttcctttcttccacaagccctctcctccccgtggattatgaggaatttgtccgcggctgt
caccttggggtcttcccctcctactatgagccctggggctacacaccagcggagtgcact
gtcatgggcatccccagcatctccaccaacctctccggctttggctgctttatggaggaa
cacatcgcagatccctcagcttacggcatttacattctggatcggaggttccgcagcctg
gatgattcatgctcacagctcacctccttcctgtacagcttctgccagcagagccggcga
cagcgcatcatccagcggaaccgcacagaacggttgtcggacttgctagattggaagtac
ctgggccggtactacatgtctgcgcgccacatggctctggccaaggcctttccagaccac
ttcacctatgaaccccatgaggtagatgcgacccaggggtaccggtacccacgaccagcc
tccgtcccgccgtcgccctcactgtctcgacactccagcccacaccagagtgaggatgag
gaagagccacgggatggacccctgggggaagacagtgagcgttatgatgaggaagaggag
gctgccaaggaccgccgcaacatccgggcacctgagtggccacgcagggcctcctgttcc
tcctccacaggtggcagcaagagaagcaactcggtggacactgggccctccagctcactc
agcacacccactgagcccctgagtcctaccagttccctgggtgaggagcgcaactaa

DBGET integrated database retrieval system