KEGG   Mus musculus (mouse): 14936Help
Entry
14936             CDS       T01002                                 

Gene name
Gys1, Gys3, MGS
Definition
glycogen synthase 1, muscle (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    14936 (Gys1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    14936 (Gys1)
   04152 AMPK signaling pathway
    14936 (Gys1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    14936 (Gys1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     14936 (Gys1)
Glycosyltransferases [BR:mmu01003]
 Polysaccharide
  Storage polysaccharide
   14936 (Gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 B4; 7 29.31 cM
AA seq 738 aa AA seqDB search
MPLSRSLSVSSLPGLEDWEDEFDPENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPYVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEVDATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPLGEDSERYDEEEEAAKDRRNIRAPEWPRRASCSSSTGGSKRSNSVDTGPSSSL
STPTEPLSPTSSLGEERN
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcagccgcagtctctctgtgtcctcgcttccaggattggaagactgggaggat
gaattcgaccccgagaacgcagtgcttttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacactgtgctgcagacgaaggcgaaggtgacaggggatgaatggggtgac
aactactatctggtgggaccatacacggagcagggtgtgaggacgcaggtagagctcctg
gagcccccaactccggaactgaagaggactttggattccatgaacagcaagggttgtaag
gtgtattttgggcgttggctgatcgaggggggacccctagtggtgctcctggatgtagga
gcctcagcttgggccctggagcgctggaagggtgagctttgggacacctgcaacatcggg
gtaccctggtacgaccgcgaggccaatgacgctgtcctgttcggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgaagagaagccgtatgtggttgcccacttccac
gaatggttggctggcgttggtctgtgtctgtgccgtgcccggcgcttgccggtggcaacc
atcttcaccactcatgccacgctgctggggcgctacctgtgtgctggcgctgtggacttc
tacaacaacctggagaatttcaatgtagacaaggaagcaggagagaggcagatctatcac
cggtactgcatggagcgtgcagcagctcactgtgcccatgtcttcactaccgtatcccag
atcaccgcaatcgaggctcaacacctccttaagagaaaaccagatattgtgacccccaac
gggctgaatgtgaagaagttctctgctatgcacgaattccagaaccttcatgctcagagc
aaagcacgaatccaggaatttgtgcgtggccatttttatgggcacctggacttcaaccta
gacaagactttgtatttctttatcgctggccgctatgagttttccaacaagggagctgat
gtgttcctggaggcattggcccggctcaactatctgctcagagtgaatggcagtgagcaa
acagttgtcgcattcttcatcatgccggcccggaccaataatttcaacgtggaaaccctg
aagggccaagccgtgcgcaaacaactatgggacacagccaatacagtcaaggagaaattt
gggaggaagctctacgaatcccttttagtggggagcctcccggacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccactcagcggcagtctttc
ccaccagtgtgcacccacaacatgctggacgactcctcagaccccatcttgaccaccatc
cgccgaattggccttttcaacagcagtgccgaccgtgtgaaggtgatttttcacccagaa
ttcctttcttccacaagccctctcctccccgtggattatgaggaatttgtccgcggctgt
caccttggggtcttcccctcctactatgagccctggggctacacaccagcggagtgcact
gtcatgggcatccccagcatctccaccaacctctccggctttggctgctttatggaggaa
cacatcgcagatccctcagcttacggcatttacattctggatcggaggttccgcagcctg
gatgattcatgctcacagctcacctccttcctgtacagcttctgccagcagagccggcga
cagcgcatcatccagcggaaccgcacagaacggttgtcggacttgctagattggaagtac
ctgggccggtactacatgtctgcgcgccacatggctctggccaaggcctttccagaccac
ttcacctatgaaccccatgaggtagatgcgacccaggggtaccggtacccacgaccagcc
tccgtcccgccgtcgccctcactgtctcgacactccagcccacaccagagtgaggatgag
gaagagccacgggatggacccctgggggaagacagtgagcgttatgatgaggaagaggag
gctgccaaggaccgccgcaacatccgggcacctgagtggccacgcagggcctcctgttcc
tcctccacaggtggcagcaagagaagcaactcggtggacactgggccctccagctcactc
agcacacccactgagcccctgagtcctaccagttccctgggtgaggagcgcaactaa

DBGET integrated database retrieval system