KEGG   Mus musculus (mouse): 14964Help
Entry
14964             CDS       T01002                                 

Gene name
H2-D1, H-2D, H2-D
Definition
(RefSeq) histocompatibility 2, D region locus 1
  KO
K06751  
major histocompatibility complex, class I
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    14964 (H2-D1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    14964 (H2-D1)
   04145 Phagosome
    14964 (H2-D1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    14964 (H2-D1)
   04612 Antigen processing and presentation
    14964 (H2-D1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    14964 (H2-D1)
  Immune diseases
   05320 Autoimmune thyroid disease
    14964 (H2-D1)
   05330 Allograft rejection
    14964 (H2-D1)
   05332 Graft-versus-host disease
    14964 (H2-D1)
  Cardiovascular diseases
   05416 Viral myocarditis
    14964 (H2-D1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    14964 (H2-D1)
  Infectious diseases
   05166 HTLV-I infection
    14964 (H2-D1)
   05168 Herpes simplex infection
    14964 (H2-D1)
   05169 Epstein-Barr virus infection
    14964 (H2-D1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14964 (H2-D1)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Immune system
   Others
    CD8A; CD8A antigen, alpha polypeptide [KO:K06458]
     14964 (H2-D1)
    CD8B; CD8B antigen, beta polypeptide 1 [KO:K06459]
     14964 (H2-D1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14964 (H2-D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17 B1; 17 18.61 cM
AA seq 362 aa AA seqDB search
MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRF
DSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQ
QMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHY
KAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLT
WQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
PPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGKGGDYALAPGSQSSEMSLRDC
KA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgatggctccgcgcacgctgctcctgctgctggcggccgccctggccccgact
cagacccgcgcgggcccacactcgatgcggtatttcgagaccgccgtgtcccggcccggc
ctcgaggagccccggtacatctctgtcggctatgtggacaacaaggagttcgtgcgcttc
gacagcgacgcggagaatccgagatatgagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggagcgggaaacacagaaagccaagggccaagagcagtggttccgagtg
agcctgaggaacctgctcggctactacaaccagagcgcgggcggctctcacacactccag
cagatgtctggctgtgacttggggtcggactggcgcctcctccgcgggtacctgcagttc
gcctatgaaggccgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcg
gacatggcggcgcagatcacccgacgcaagtgggagcagagtggtgctgcagagcattac
aaggcctacctggagggcgagtgcgtggagtggctccacagatacctgaagaacgggaac
gcgacgctgctgcgcacagattccccaaaggcacatgtgacccatcaccccagatctaaa
ggtgaagtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggagctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaat
tacacatgccgtgtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcct
cctccgtccactgactcttacatggtgatcgttgctgttctgggtgtccttggagctatg
gccatcattggagctgtggtggcttttgtgatgaagagaaggagaaacacaggtggaaaa
ggaggggactatgctctggctccaggctcccagagctctgaaatgtctctccgagattgt
aaagcgtga

DBGET integrated database retrieval system