KEGG   Mus musculus (mouse): 14999Help
Entry
14999             CDS       T01002                                 

Gene name
H2-DMb1, AI385589, H-2Mb1, H2-Mb1
Definition
histocompatibility 2, class II, locus Mb1
Orthology
K06752  
major histocompatibility complex, class II
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    14999 (H2-DMb1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    14999 (H2-DMb1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    14999 (H2-DMb1)
   04672 Intestinal immune network for IgA production
    14999 (H2-DMb1)
 Human Diseases
  Immune diseases
   05310 Asthma
    14999 (H2-DMb1)
   05322 Systemic lupus erythematosus
    14999 (H2-DMb1)
   05323 Rheumatoid arthritis
    14999 (H2-DMb1)
   05320 Autoimmune thyroid disease
    14999 (H2-DMb1)
   05321 Inflammatiory bowel disease (IBD)
    14999 (H2-DMb1)
   05330 Allograft rejection
    14999 (H2-DMb1)
   05332 Graft-versus-host disease
    14999 (H2-DMb1)
  Cardiovascular diseases
   05416 Viral myocarditis
    14999 (H2-DMb1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    14999 (H2-DMb1)
  Infectious diseases
   05150 Staphylococcus aureus infection
    14999 (H2-DMb1)
   05152 Tuberculosis
    14999 (H2-DMb1)
   05166 HTLV-I infection
    14999 (H2-DMb1)
   05164 Influenza A
    14999 (H2-DMb1)
   05168 Herpes simplex infection
    14999 (H2-DMb1)
   05145 Toxoplasmosis
    14999 (H2-DMb1)
   05140 Leishmaniasis
    14999 (H2-DMb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14999 (H2-DMb1)
  Exosomal proteins of epithelial cells
   14999 (H2-DMb1)
  Exosomal proteins of breast milk
   14999 (H2-DMb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17 17.98 cM
AA seq 261 aa AA seqDB search
MAALWLLLLVLSLDCMGAGGFVAHVESTCVLDDAGTPQDFTYCVSFNKDLLACWDPDVGK
IVPCEFGVLYPWAENFSRILNKEESLLQRLQNGLLDCASHTQPFWNALTHRTRAPSVRVA
QTTPFNTREPVMLACYVWGFYPADVTITWMKNGQLVPSHSNKEKTAQPNGDWTYQTVSYL
ALTPSYGDVYTCVVQHSGTSEPIRGDWTPGLSPIQTVKVSVSAATLGLGFIIFCVGFFRW
RKSHSSSYTPLSGSTYPEGQH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctgcactctggctgctgctgctggtcctcagtctggactgtatgggggcaggtggc
tttgtggctcatgtggaaagcacgtgcgtgctggatgatgctgggaccccacaggacttc
acatactgtgtttccttcaacaaagatctgctggcctgctgggatccagatgtgggaaaa
atagtcccctgtgaatttggggtgctgtatccatgggccgaaaatttttcaaggatcctc
aacaaagaagagagccttctccagcgtttgcaaaacgggcttctggactgtgcctcccac
acccagcccttctggaatgcgctgacccacagaacgagagcgccatctgtccgagtagcc
caaaccacaccttttaacacaagggagccggtgatgctggcctgctacgtctggggcttc
tatccagcggatgtgaccatcacatggatgaagaatgggcagcttgtcccttcccacagc
aacaaggagaagacggctcagcccaatggagactggacataccagacagtctcctaccta
gccctaaccccttcctacggggacgtctacacctgcgtggttcagcacagcgggacctct
gagcccatccgaggggactggacacctgggctgtcccccatccagacagtgaaggtctct
gtgtctgcagccaccctgggcctgggcttcatcatcttctgtgttggcttcttcagatgg
cgcaagtctcattcctccagctacactcctctctctggatccacctacccggaaggacag
cattag

DBGET integrated database retrieval system