KEGG   Mus musculus (mouse): 14999Help
Entry
14999             CDS       T01002                                 

Gene name
H2-DMb1, AI385589, H-2Mb1, H2-Mb1
Definition
histocompatibility 2, class II, locus Mb1
Orthology
K06752  
major histocompatibility complex, class II
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Intestinal immune network for IgA production
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
HTLV-I infection
Herpes simplex infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:mmu04514]
Cellular Processes; Transport and catabolism; Phagosome [PATH:mmu04145]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:mmu04612]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:mmu04672]
Human Diseases; Immune diseases; Asthma [PATH:mmu05310]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:mmu05322]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:mmu05323]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:mmu05320]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:mmu05321]
Human Diseases; Immune diseases; Allograft rejection [PATH:mmu05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:mmu05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:mmu05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:mmu04940]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:mmu05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:mmu05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
Human Diseases; Infectious diseases; Influenza A [PATH:mmu05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mmu05168]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mmu05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:mmu05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17 17.98 cM
AA seq 261 aa AA seqDB search
MAALWLLLLVLSLDCMGAGGFVAHVESTCVLDDAGTPQDFTYCVSFNKDLLACWDPDVGK
IVPCEFGVLYPWAENFSRILNKEESLLQRLQNGLLDCASHTQPFWNALTHRTRAPSVRVA
QTTPFNTREPVMLACYVWGFYPADVTITWMKNGQLVPSHSNKEKTAQPNGDWTYQTVSYL
ALTPSYGDVYTCVVQHSGTSEPIRGDWTPGLSPIQTVKVSVSAATLGLGFIIFCVGFFRW
RKSHSSSYTPLSGSTYPEGQH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctgcactctggctgctgctgctggtcctcagtctggactgtatgggggcaggtggc
tttgtggctcatgtggaaagcacgtgcgtgctggatgatgctgggaccccacaggacttc
acatactgtgtttccttcaacaaagatctgctggcctgctgggatccagatgtgggaaaa
atagtcccctgtgaatttggggtgctgtatccatgggccgaaaatttttcaaggatcctc
aacaaagaagagagccttctccagcgtttgcaaaacgggcttctggactgtgcctcccac
acccagcccttctggaatgcgctgacccacagaacgagagcgccatctgtccgagtagcc
caaaccacaccttttaacacaagggagccggtgatgctggcctgctacgtctggggcttc
tatccagcggatgtgaccatcacatggatgaagaatgggcagcttgtcccttcccacagc
aacaaggagaagacggctcagcccaatggagactggacataccagacagtctcctaccta
gccctaaccccttcctacggggacgtctacacctgcgtggttcagcacagcgggacctct
gagcccatccgaggggactggacacctgggctgtcccccatccagacagtgaaggtctct
gtgtctgcagccaccctgggcctgggcttcatcatcttctgtgttggcttcttcagatgg
cgcaagtctcattcctccagctacactcctctctctggatccacctacccggaaggacag
cattag

DBGET integrated database retrieval system