KEGG   Mus musculus (mouse): 15115Help
Entry
15115             CDS       T01002                                 

Gene name
Hars, MMHRS
Definition
(RefSeq) histidyl-tRNA synthetase
  KO
K01892  
histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
mmu  Mus musculus (mouse)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    15115 (Hars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     15115 (Hars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   15115 (Hars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    15115 (Hars)
 Prokaryotic Type
    15115 (Hars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18; 18 B2
AA seq 509 aa AA seqDB search
MADRAALEELVRLQGAHVRGLKEQKASAEQIEEEVTKLLKLKAQLGQDEGKQKFVLKTPK
GTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
QFDPMIPDAECLKIMCEILSSLQIGNFLVKVNDRRILDGMFAVCGVPDSKFRTICSSVDK
LDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQAVEGLG
DLKLLFEYLILFGIDDKISFDLSLARGLDYYTGVIYEAVLLQMPTQAGEEPLGVGSIAAG
GRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEASEEKVRTTETQVLVASAQKKL
LEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRS
VASREEVDVRREDLVEEIRRRTNQPLSTC
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcgtgctgctctggaggagctggtacgactccagggagcgcatgtgaggggc
cttaaggagcagaaagcgtccgctgagcagatcgaggaggaggtgacgaaactcctaaaa
ctgaaggcacagctgggccaggatgaaggcaaacagaagtttgtgctcaaaacccccaag
ggcacgagagactatagtccccggcagatggcggtccgggaaaaggtgtttgatgtcatc
atccgctgtttcaaacgccatggagcagaagtgattgatacacctgtgtttgaactaaag
gaaacactgactggaaagtacggagaagactcaaagcttatctatgacttgaaggaccag
ggtggggagctgctgtccctccgttatgaccttactgtcccttttgctcgctatctggca
atgaataaactgaccaacattaaacgctaccatatagcaaaggtgtatcgccgggacaac
ccagctatgacccgaggccgttaccgtgaattctatcaatgcgattttgacattgccgga
cagttcgaccccatgattcctgatgcagagtgcctaaagattatgtgcgagatcctgagt
tcacttcagatcggcaacttcctggtcaaggtaaacgacaggcgcatcctagatgggatg
tttgctgtctgtggtgttcctgatagcaagttccgtaccatctgctcctcggtggacaag
ctagacaaggtttcctgggaggaagtgaagaatgagatggtgggagagaagggccttgca
ccggaagtggctgatcgcatcggggactatgtccagcagcatggtggggtttctctggtg
gagcagttactgcaggatcctaaactctcccaaaacaaacaggctgtagagggcttggga
gacctaaagctgctctttgagtatctaatcctgtttggcattgatgacaagatctccttt
gacctgagccttgctcgggggctagactactatactggggtcatctatgaggcagtgctg
ctacagatgccaacccaagctggggaagagcccctgggtgtgggcagcatagctgctgga
gggcgctacgatggcctggttggcatgtttgaccccaaggggcgcaaggtgccatgcgtt
gggctcagtattggagtggagcggatcttttccattgtagagcaaagattagaggcttca
gaggaaaaggtacggaccacagagacgcaggtgcttgtggcatctgcacagaagaagctg
ctggaggagagactgaagcttgtctcagagttatgggatgctgggatcaaggctgagctg
ctgtacaagaagaacccgaagttactaaaccagttgcagtactgtgaggaggcaggcatc
ccactggtggccatcattggtgagcaggaactcaaggatggcgtcatcaagctccgctcg
gtggccagcagagaggaggtggatgtccgaagagaagaccttgtggaggaaatcagaaga
agaacaaatcagcccctctccacctgctga

DBGET integrated database retrieval system