KEGG   Mus musculus (mouse): 15162Help
Entry
15162             CDS       T01002                                 

Gene name
Hck, AI849071, Bmk
Definition
(RefSeq) hemopoietic cell kinase
  KO
K08893  
hemopoietic cell kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Chemokine signaling pathway
Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    15162 (Hck)
   04062 Chemokine signaling pathway
    15162 (Hck)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     15162 (Hck)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Src family
   15162 (Hck)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    15162 (Hck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 H1; 2 75.41 cM
AA seq 524 aa AA seqDB search
MGGRSSCEDPGCPRSEGRAPRMGCVKSRFLRDGSKASKTEPSANQKGPVYVPDPTSSSKL
GPNNSNSMPPGFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGEWWKARSLAT
KKEGYIPSNYVARVNSLETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSL
SVRDFDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVLHYKKGKDGLCQKLSVPCV
SPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAF
LAEANLMKSLQHDKLVKLHAVVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFS
AQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIK
WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDNC
PEELYNIMIRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
ctggggggtcggtctagctgcgaggatccgggctgcccacgaagcgaagggcgggcgccc
aggatgggatgcgtgaagtccaggttcctccgagatggaagcaaggcctcaaaaacagag
ccaagtgccaatcagaagggccctgtgtatgtgccggatcccacgtcctccagcaagctg
ggaccaaacaacagcaacagcatgcccccagggtttgtggagggctctgaggataccatt
gtggtcgcactgtacgactatgaggctattcaccgtgaagacctcagcttccagaaggga
gaccagatggtggttctggaggaggctggggagtggtggaaggcacggtccctggctacc
aagaaggaaggctacatcccaagcaactatgtggctcgagttaactctttggagacagaa
gagtggttcttcaaggggatcagccggaaggatgcagagcgccacctcctggctccaggc
aacatgctgggctccttcatgatccgggacagtgagaccaccaaagggagctactcgttg
tctgttcgagactttgacccccagcacggagacaccgtgaagcactataagatccggacg
ctggacagtggaggcttctacatctctccaaggagcaccttcagcagcctgcaggaactc
gtgctccactacaagaaggggaaggatgggctctgccagaagctgtcagtgccctgtgtg
tctcccaaaccccagaagccatgggagaaagatgcttgggagattcctcgagaatccctc
cagatggagaagaaacttggagctgggcagtttggagaagtgtggatggccacctacaac
aagcacaccaaagtggcggtgaagacaatgaagccagggagcatgtccgtggaggccttc
ctggctgaggccaacctgatgaagtcgctgcagcatgacaaactggtgaagctacacgct
gtggtctctcaggagcccatctttattgtcacggagttcatggccaaaggaagcctgctg
gactttctcaagagtgaagaaggcagcaagcagccactgccaaaactcattgacttctca
gcccagatctcagaaggcatggccttcattgagcagaggaactacatccaccgagacctg
agggctgccaacatcttagtctctgcatcactggtgtgtaagattgctgactttggactg
gcacgaatcatcgaggacaatgagtacacagctcgggaaggagccaagttccccatcaag
tggacagctcctgaagccatcaactttggttccttcaccatcaagtcagatgtctggtcc
tttggtatcctgctgatggaaattgtcacctatggccggatcccttacccaggtatgtca
aacccagaggtgattcgggcactagagcatgggtaccgtatgcctcgaccagataactgt
ccagaagagctctacaatatcatgatccgctgctggaagaaccgccccgaggaacggccc
acctttgaatacatccagagtgtgctggatgacttctacacggccactgagagccagtat
cagcagcagccttga

DBGET integrated database retrieval system