KEGG   Mus musculus (mouse): 15165Help
Entry
15165             CDS       T01002                                 

Gene name
Hcn1, Bcng1, C630013B14Rik, HAC2
Definition
(RefSeq) hyperpolarization-activated, cyclic nucleotide-gated K+ 1
  KO
K04954  
hyperpolarization activated cyclic nucleotide-gated potassium channel 1
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Brain cyclic nucleotide-gated channel (HCN)
   15165 (Hcn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13 D2.3; 13 66.34 cM
AA seq 910 aa AA seqDB search
MEGGGKPNSASNSRDDGNSVFPSKAPATGPVAADKRLGTPPGGGAAGKEHGNSVCFKVDG
GGGEEPAGSFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAG
FWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLI
MNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMDSEVYKTA
RALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHW
DGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSD
LWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKI
HDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKL
RFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTA
SVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQKFQKDLNT
GVFNNQENEILKQIVKHDREMVQAIPPINYPQMTALNCTSSTTTPTSRMRTQSPPVYTAT
SLSHSNLHSPSPSTQTPQPSAILSPCSYTTAVCSPPIQSPLATRTFHYASPTASQLSLMQ
QPQQQLPQSQVQQTQTQTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPQTPG
SSTPKNEVHKSTQALHNTNLTKEVRPLSASQPSLPHEVSTLISRPHPTVGESLASIPQPV
AAVHSTGLQAGSRSTVPQRVTLFRQMSSGAIPPNRGVPPAPPPPAAVQRESPSVLNTDPD
AEKPRFASNL
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcggcggcaaacccaactccgcgtccaacagccgcgacgatggcaacagcgtc
ttcccctccaaggcgcccgcgacggggccggtggcggccgacaagcgcctggggaccccg
ccggggggcggcgcggccgggaaggaacatggcaactccgtgtgcttcaaggtggacggc
ggcggaggagaggagccggcgggcagcttcgaggatgccgaggggccccggcggcagtat
ggtttcatgcagaggcagttcacctccatgctgcagcctggggtcaacaaattctccctc
cgcatgtttgggagccagaaggcggtggagaaggagcaggaaagggttaaaactgcaggc
ttctggattatccatccgtacagtgacttcaggttttattgggatttaatcatgcttata
atgatggttggaaatttggtcatcataccagttggaatcacgttcttcacagagcagacg
acaacaccgtggattattttcaacgtggcatccgatactgttttcctgttggacttaatc
atgaattttaggactgggactgtcaatgaagacagctcggaaatcatcctggaccctaaa
gtgatcaagatgaattatttaaaaagctggtttgtggtggacttcatctcatcgatcccg
gtggattatatctttctcattgtagagaaagggatggactcagaagtttacaagacagcc
agagcacttcgtatcgtgaggtttacaaaaattctcagtctcttgcggttattacgcctt
tcaaggttaatcagatacatacaccagtgggaagagatattccacatgacctatgacctc
gccagtgctgtggtgaggatcttcaacctcattggcatgatgctgcttctgtgccactgg
gatggctgtcttcagttcctggttcccctgctgcaggacttcccaccagattgctgggtt
tctctgaatgaaatggttaatgattcctggggaaaacaatattcctacgcactcttcaaa
gctatgagtcacatgctgtgcattggttatggcgcccaagcccctgtcagcatgtctgac
ctctggattaccatgctgagcatgattgtgggcgccacctgctacgcaatgtttgttggc
catgccacagctttgatccagtctttggactcttcaaggaggcagtatcaagagaagtat
aagcaagtagagcaatacatgtcattccacaagttaccagctgacatgcgccagaagata
catgattactatgagcaccgataccaaggcaagatcttcgatgaagaaaatattctcagt
gagcttaatgatcctctgagagaggaaatagtcaacttcaactgccggaaactggtggca
actatgcctctttttgctaacgccgatcccaatttcgtgacggccatgctgagcaagctg
agatttgaggtgttccagcccggagactatatcattcgagaaggagctgtggggaagaaa
atgtatttcatccagcacggtgttgctggcgttatcaccaagtccagtaaagaaatgaag
ctgacagatggctcttacttcggagagatatgcctgctgaccaagggccggcgcactgcc
agtgtccgagctgatacctactgtcgtctttactccctttcggtggacaatttcaatgag
gtcttggaggaatatccaatgatgagaagagcctttgagacagttgctattgaccgactc
gatcggataggcaagaaaaactctattctcctgcagaagttccagaaggatctaaacact
ggtgttttcaacaaccaggagaacgagatcctgaagcagatcgtgaagcatgaccgagag
atggtacaagctatccctccaatcaactatcctcaaatgacagccctcaactgcacatct
tcaaccaccaccccaacctcccgcatgaggacccaatctccgccagtctacaccgcaacc
agcctgtctcacagcaatctgcactcacccagtcccagcacacagacgccccaaccctca
gccatcctttcaccctgctcctataccacagcagtctgcagtcctcctatacagagcccc
ctggccacacgaactttccattatgcctctcccactgcgtcccagctgtcactcatgcag
cagcctcagcagcaactaccgcagtcccaggtacagcagactcagactcagactcagcag
cagcagcagcaacagcagcagcagcagcagcagcaacagcaacaacagcagcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcagcagcagccacagacacctggt
agctccacaccgaaaaatgaagtgcacaagagcacacaagcccttcataacaccaacctg
accaaagaagtcaggcccctttccgcctcgcagccttctctgccccatgaggtctccact
ttgatctccagacctcatcccactgtgggcgaatccctggcctctatccctcaacccgtg
gcagcagtccacagcactggccttcaggcagggagcaggagcacagtgccacaacgtgtc
accttgttccgacagatgtcctcgggagccatcccccccaaccgaggagtgcctccagca
ccccctccaccagcagctgtgcagagagagtctccctcagtcctaaatacagacccagat
gcagaaaaaccccgttttgcttcgaatttatga

DBGET integrated database retrieval system