KEGG   Mus musculus (mouse): 15166Help
Entry
15166             CDS       T01002                                 

Gene name
Hcn2, BCNG2, HAC1, trls
Definition
(RefSeq) hyperpolarization-activated, cyclic nucleotide-gated K+ 2
  KO
K04955  
hyperpolarization activated cyclic nucleotide-gated potassium channel 2
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    15166 (Hcn2)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Brain cyclic nucleotide-gated channel (HCN)
   15166 (Hcn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10; 10 C1
AA seq 863 aa AA seqDB search
MDARGGGGRPGDSPGTTPAPGPPPPPPPPAPPQPQPPPAPPPNPTTPSHPESADEPGPRA
RLCSRDSACTPGAAKGGANGECGRGEPQCSPEGPARGPKVSFSCRGAASGPSAAEEAGSE
EAGPAGEPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPY
SDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGI
VIEDNTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVR
FTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFL
VPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLS
MIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHR
YQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQP
GDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTY
CRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLSSGVFNNQE
NAIIQEIVKYDREMVQQAELGQRVGLFPPPPPPQVTSAIATLQQAVAMSFCPQVARPLVG
PLALGSPRLVRRAPPGPLPPAASPGPPAASPPAAPSSPRAPRTSPYGVPGSPATRVGPAL
PARRLSRASRPLSASQPSLPHGVPAPSPAASARPASSSTPRLGPAPTARTAAPSPDRRDS
ASPGAASGLDPLDSARSRLSSNL
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcgcgggggcggcgggcggccgggcgatagtccgggcacgacccctgcgccg
gggccgccgccaccgccgccgccgcccgcgccccctcagcctcagccaccacccgcgcca
cccccgaaccccacgaccccctcgcacccggagtcggcggacgagcccggcccgcgcgcc
cggctctgcagccgcgacagcgcctgcacccctggcgcggccaagggcggcgcgaatggc
gagtgcgggcgcggggagccgcagtgcagccccgagggccccgcgcgcggccccaaggtt
tcgttctcatgccgcggggcggcctccgggccctcggcggccgaggaggcgggcagcgag
gaggcgggcccggcgggtgagccgcgcggcagccaggctagcttcctgcagcgccaattc
ggggcgcttctgcagcccggcgtcaacaagttctccctgcggatgttcggcagccagaag
gccgtggagcgcgagcaggaacgcgtgaagtcggcgggggcctggatcatccacccctac
agcgacttcaggttctactgggacttcaccatgctgttgttcatggtgggaaatctcatt
atcattcccgtgggcatcactttcttcaaggacgagaccaccgcgccctggatcgtcttc
aacgtggtctcggacactttcttcctcatggacttggtgttgaacttccgcaccggcatt
gttattgaggacaacacggagatcatcctggaccccgagaagataaagaagaagtacttg
cgtacgtggttcgtggtggacttcgtgtcatccatcccggtggactacatcttcctcata
gtggagaagggaatcgactccgaggtctacaagacagcgcgtgctctgcgcatcgtgcgc
ttcaccaagatcctcagtctgctgcggctgctgcggctatcacggctcatccgatatatc
caccagtgggaagagattttccacatgacctacgacctggcaagtgcagtgatgcgcatc
tgtaacctgatcagcatgatgctactgctctgccactgggacggttgcctgcagttcctg
gtgcccatgctgcaagacttccccagcgactgctgggtgtccatcaacaacatggtgaac
cactcgtggagcgagctctactcgttcgcgctcttcaaggccatgagccacatgctgtgc
atcggctacgggcggcaggcgcccgagagcatgacagacatctggctgaccatgctcagc
atgatcgtaggcgccacctgctatgccatgttcattgggcacgccactgcgctcatccag
tccctggattcgtcacggcgccaataccaggagaagtacaagcaagtagagcaatacatg
tccttccacaaactgcccgctgacttccgccagaagatccacgattactatgaacaccgg
taccaagggaagatgtttgatgaggacagcatccttggggaactcaacgggccactgcgt
gaggagattgtgaacttcaactgccggaagctggtggcttccatgccgctgtttgccaat
gcagaccccaacttcgtcacagccatgctgacaaagctcaaatttgaggtcttccagcct
ggagattacatcatccgagaggggaccatcgggaagaagatgtacttcatccagcatggg
gtggtgagcgtgctcaccaagggcaacaaggagatgaagctgtcggatggctcctatttc
ggggagatctgcttgctcacgaggggccggcgtacggccagcgtgcgagctgacacctac
tgtcgcctctactcactgagtgtggacaatttcaacgaggtgctggaggaataccccatg
atgcggcgtgcctttgagactgtggctattgaccggctagatcgcataggcaagaagaac
tccatcttgctgcacaaggttcagcatgatctcagctcaggtgtgttcaacaaccaggag
aatgccatcatccaggagattgtcaaatatgaccgtgagatggtgcagcaggcagagctt
ggccagcgtgtggggctcttcccaccaccgccaccaccgcaggtcacatcggccattgcc
accctacagcaggctgtggccatgagcttctgcccgcaggtggcccgcccgctcgtgggg
cccctggcgctaggctccccacgcctagtgcgccgcgcgcccccagggcctctgcctcct
gcagcctcgccagggccacccgcagcaagccccccggctgcaccctcgagccctcgggca
ccgcggacctcaccctacggtgtgcctggctctccggcaacgcgtgtggggcccgcattg
cccgcacgtcgcctgagccgcgcctcgcgcccactgtccgcctcgcagccctcgctgccc
catggcgtgcccgcgcccagccccgcggcctctgcgcgcccggccagcagctccacgccg
cgcctgggacccgcacccaccgcccggaccgccgcgcccagtccggaccgcagggactca
gcctcgccgggcgctgccagtggcctcgacccactggactctgcgcgctcgcgcctctct
tccaacttgtga

DBGET integrated database retrieval system