KEGG   Mus musculus (mouse): 15183Help
Entry
15183             CDS       T01002                                 

Gene name
Hdac3, AW537363
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    15183 (Hdac3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    15183 (Hdac3)
  Substance dependence
   05034 Alcoholism
    15183 (Hdac3)
  Infectious diseases
   05165 Human papillomavirus infection
    15183 (Hdac3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     15183 (Hdac3)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     15183 (Hdac3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18 19.81 cM; 18 B3
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
SQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcgtatttctacgaccccgatgtgggcaacttccactatggagct
ggacacccaatgaaacctcatcgcctggcattgactcatagcctagtcctgcattatggt
ctctataagaagatgatcgtcttcaagccttaccaggcctcccagcatgacatgtgccgc
ttccattctgaggactacatcgacttcctgcagagagtcagccccaccaatatgcagggt
ttcaccaagagccttaatgccttcaacgtgggtgatgactgcccagtgtttccaggactt
ttcgagttctgctcccgttacacaggcgcatctctgcaaggagcaacacagctaaacaac
aagatctgtgatattgccatcaactgggccggtggtctacatcatgccaagaaatttgag
gcctctggcttctgctatgtcaatgacatagtaattggtatcctggagctgcttaagtac
caccctcgggtgctctacattgatatcgacatccaccatggtgacggggttcaggaagcc
ttctacctcactgaccgggtcatgactgtgtccttccacaaatacggaaattacttcttt
cctggaacaggtgacatgtatgaagttggagcagagagtggccgctactattgtctcaat
gtgcccttacgagatggcattgatgaccagagttacaagcaccttttccagccagtcatc
agccaggtggtggacttctaccagccgacgtgcatcgtgctccagtgtggcgctgactcc
ctgggctgtgatcgattaggctgcttcaatctcagcattcgaggacatggggaatgtgtt
gaatatgtcaagagtttcaatatccctctcctggtactgggaggtggtggctacactgtc
cgaaatgttgcccggtgttggacatatgaaacatctctgctggtagaagaggccattagt
gaggaacttccctatagtgaatacttcgagtactttgccccagatttcacactccatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacttgaagatgctgaaccatgcacccagtgtccagattcatgatgtc
ccggcagacctcctgacgtatgacaggactgacgaggccgacgctgaagagagaggtccc
gaggagaactacagcaggccagaagcacccaatgagttctatgatggcgaccatgacaac
gacaaggaaagtgatgtggagatttag

DBGET integrated database retrieval system