KEGG   Mus musculus (mouse): 15183Help
Entry
15183             CDS       T01002                                 

Gene name
Hdac3, AW537363
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    15183 (Hdac3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    15183 (Hdac3)
  Substance dependence
   05034 Alcoholism
    15183 (Hdac3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     15183 (Hdac3)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     15183 (Hdac3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18 19.81 cM; 18 B3
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
SQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcgtatttctacgaccccgatgtgggcaacttccactatggagct
ggacacccaatgaaacctcatcgcctggcattgactcatagcctagtcctgcattatggt
ctctataagaagatgatcgtcttcaagccttaccaggcctcccagcatgacatgtgccgc
ttccattctgaggactacatcgacttcctgcagagagtcagccccaccaatatgcagggt
ttcaccaagagccttaatgccttcaacgtgggtgatgactgcccagtgtttccaggactt
ttcgagttctgctcccgttacacaggcgcatctctgcaaggagcaacacagctaaacaac
aagatctgtgatattgccatcaactgggccggtggtctacatcatgccaagaaatttgag
gcctctggcttctgctatgtcaatgacatagtaattggtatcctggagctgcttaagtac
caccctcgggtgctctacattgatatcgacatccaccatggtgacggggttcaggaagcc
ttctacctcactgaccgggtcatgactgtgtccttccacaaatacggaaattacttcttt
cctggaacaggtgacatgtatgaagttggagcagagagtggccgctactattgtctcaat
gtgcccttacgagatggcattgatgaccagagttacaagcaccttttccagccagtcatc
agccaggtggtggacttctaccagccgacgtgcatcgtgctccagtgtggcgctgactcc
ctgggctgtgatcgattaggctgcttcaatctcagcattcgaggacatggggaatgtgtt
gaatatgtcaagagtttcaatatccctctcctggtactgggaggtggtggctacactgtc
cgaaatgttgcccggtgttggacatatgaaacatctctgctggtagaagaggccattagt
gaggaacttccctatagtgaatacttcgagtactttgccccagatttcacactccatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacttgaagatgctgaaccatgcacccagtgtccagattcatgatgtc
ccggcagacctcctgacgtatgacaggactgacgaggccgacgctgaagagagaggtccc
gaggagaactacagcaggccagaagcacccaatgagttctatgatggcgaccatgacaac
gacaaggaaagtgatgtggagatttag

DBGET integrated database retrieval system