KEGG   Mus musculus (mouse): 15185Help
Entry
15185             CDS       T01002                                 

Gene name
Hdac6, Hd6, Hdac5, Sfc6, mHDA2
Definition
(RefSeq) histone deacetylase 6 (EC:3.5.1.98)
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    15185 (Hdac6)
  Substance dependence
   05034 Alcoholism
    15185 (Hdac6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     15185 (Hdac6)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     15185 (Hdac6)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     15185 (Hdac6)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     15185 (Hdac6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X A1.1; X 3.58 cM
AA seq 1149 aa AA seqDB search
MTSTGQDSSTRQRKSRHNPQSPLQESSATLKRGGKKCAVPHSSPNLAEVKKKGKMKKLSQ
PAEEDLVVGLQGLDLNPETRVPVGTGLVFDEQLNDFHCLWDDSFPESPERLHAIREQLIL
EGLLGRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLAETYDSVYLHPNSY
SCACLATGSVLRLVDALMGAEIRNGMAVIRPPGHHAQHNLMDGYCMFNHLAVAARYAQKK
HRIQRVLIVDWDVHHGQGTQFIFDQDPSVLYFSIHRYEHGRFWPHLKASNWSTIGFGQGQ
GYTINVPWNQTGMRDADYIAAFLHILLPVASEFQPQLVLVAAGFDALHGDPKGEMAATPA
GFAHLTHLLMGLAGGKLILSLEGGYNLRALAKGVSASLHTLLGDPCPMLESCVVPCASAQ
TSIYCTLEALEPFWEVLERSVETQEEDEVEEAVLEEEEEEGGWEATALPMDTWPLLQNRT
GLVYDEKMMSHCNLWDNHHPETPQRILRIMCHLEEVGLAARCLILPARPALDSELLTCHS
AEYVEHLRTTEKMKTRDLHREGANFDSIYICPSTFACAKLATGAACRLVEAVLSGEVLNG
IAVVRPPGHHAEPNAACGFCFFNSVAVAARHAQIIAGRALRILIVDWDVHHGNGTQHIFE
DDPSVLYVSLHRYDRGTFFPMGDEGASSQVGRDAGIGFTVNVPWNGPRMGDADYLAAWHR
LVLPIAYEFNPELVLISAGFDAAQGDPLGGCQVTPEGYAHLTHLLMGLAGGRIILILEGG
YNLASISESMAACTHSLLGDPPPQLTLLRPPQSGALVSISEVIQVHRKYWRSLRLMKMED
KEECSSSRLVIKKLPPTASPVSAKEMTTPKGKVPEESVRKTIAALPGKESTLGQAKSKMA
KAVLAQGQSSEQAAKGTTLDLATSKETVGGATTDLWASAAAPENFPNQTTSVEALGETEP
TPPASHTNKQTTGASPLQGVTAQQSLQLGVLSTLELSREAEEAHDSEEGLLGEAAGGQDM
NSLMLTQGFGDFNTQDVFYAVTPLSWCPHLMAVCPIPAAGLDVSQPCKTCGTVQENWVCL
TCYQVYCSRYVNAHMVCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNK
FGEDMPHSH
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccggccaagattcttctactagacagcgaaagagtaggcacaatccccag
tcaccccttcaggaatccagcgccaccttgaagcgtggtggaaagaagtgtgctgtaccc
cactccagccccaatctagcggaggtaaagaagaaaggcaaaatgaagaagctgagccaa
ccagctgaagaggacctagttgtggggcttcaagggctggatctgaaccctgagacaaga
gtgccagttggtactggattggtgtttgatgaacaactaaatgacttccattgcctttgg
gatgacagcttccctgaaagccctgagcggctccatgccatcagagagcaactgatcctg
gagggcctcctgggccgctgtgtgtcctttcaggcccggttcgctgagaaggaggagctg
atgttggttcacagcctggaatacattgatctgatggagacaacccagtacatgaatgaa
ggggagcttcgagtactggcagaaacctatgattcagtgtatctgcatccgaactcatat
tcctgtgcctgcctggctacaggctctgtcctccggctggtagatgcactcatgggggct
gagattcggaatggcatggccgtcatcaggcctcctggacaccatgctcagcacaatctt
atggatgggtattgcatgttcaaccatctggctgtggctgcccgctatgcgcaaaagaag
caccgcattcagagggttctcatcgtggactgggatgtgcaccatggtcaaggaacacag
ttcatcttcgaccaggaccccagtgtcctttatttctccatccaccgatatgaacatggt
cgcttctggccccaccttaaggcttctaactggtccactataggttttggccaaggccaa
ggatataccatcaatgtaccttggaaccagacgggcatgcgggacgctgactacattgct
gctttcctgcacatcctgctgccagttgcctcggagtttcagcctcaactggtcttggtg
gccgctggatttgatgccctccacggagaccccaagggagagatggctgccacgccagca
ggatttgcccacctaacccatttgctcatgggtttggcaggaggcaagttgattctgtcc
ctggagggtggctataacctccgtgccctggctaagggagtcagtgcttcactccacacc
cttcttggagacccttgccccatgctggagtcctgtgttgtaccttgtgcaagcgcccag
acttccatctactgcactctagaagcccttgaacccttctgggaggtcctggagagatca
gttgagacccaggaggaagatgaagtggaagaagccgtgctagaagaggaggaggaggaa
ggtggctgggaggccactgcactgcccatggatacatggccactgctccagaaccgcact
gggctggtctatgatgagaagatgatgagtcactgcaacctctgggacaatcatcaccct
gagacacctcagcgcatcttacgcatcatgtgtcacctggaggaggtgggccttgcggct
cgctgtctcatcctacctgctcggcctgccctggactctgagctccttacctgccacagt
gctgagtacgtggagcatctccgcaccacagaaaagatgaaaacccgggatctgcaccgt
gaaggtgccaactttgactccatctacatctgccccagcacctttgcctgcgcaaagctt
gccacaggcgctgcctgccgcctggtggaagctgtgctctcgggagaggttctaaatggc
attgcagtagtgcgccctccaggacaccacgcggagccaaatgctgcctgtggtttctgc
tttttcaactcagtagctgtagctgctcgccatgcccagatcattgctggacgtgccctg
cggatcctaatcgtggattgggatgttcatcatggtaatggaactcagcacatatttgag
gatgaccctagtgtattatacgtgtccctgcaccggtatgaccgtggcactttcttcccc
atgggggatgagggtgccagtagccaagtaggccgagatgcaggtataggcttcactgtc
aatgtgccctggaatgggccccgcatgggtgatgctgattacctggctgcatggcatcgt
ctggtacttcccatcgcctatgagtttaacccagaactggtgctgatctcagctggcttt
gatgctgcacaaggggatccgctggggggctgccaagtaacaccggagggttatgcccac
ctcacccacctactgatgggccttgctggtggccgtattattcttattctagagggtgga
tacaatttggcatctatctctgagtctatggctgcctgcacccattccctccttggagac
ccaccaccccagcttactttgctgcgaccgccacagtcaggagccctggtttcaatcagt
gaggtcatccaagtccatcgcaaatactggcgcagtttgcggttgatgaaaatggaagac
aaggaagaatgctctagttctaggcttgtcatcaagaagttgcccccaacagccagtcct
gtatcagctaaggaaatgaccacaccgaaaggaaaggttcctgaagaaagcgtgaggaag
accatagcagcactacctgggaaagagtctactctaggccaggctaaatcaaagatggct
aaggctgtgcttgctcagggccagtcctcagaacaagctgctaagggaactacactggat
ctggctacctcaaaggagactgtgggaggagccacgacggacctgtgggcctcagcagct
gctcctgaaaacttccctaaccagaccacctctgtggaggctttgggagaaactgagcca
acgcctccagcctcgcatacaaacaagcagaccacaggggcttcacctctgcagggagtc
acggctcagcagtccctacagcttggggttctcagcactttggagctaagcagagaagca
gaggaagcccatgattctgaggagggcctgctaggggaagccgctggaggtcaggacatg
aacagcttgatgctgacacaaggatttggggactttaatacccaggatgtattttatgct
gtgaccccactatcctggtgtccccatttgatggcagtatgccccattcctgcagcaggc
ctagatgtgtcccaaccttgtaagacctgtggaacagtccaggagaactgggtgtgtctg
acttgctatcaggtgtactgcagtcgctatgtcaatgcccatatggtctgccaccatgaa
gcctctgaacacccgctggtcctcagctgtgttgacctgtctacctggtgttatgtctgt
caggcttatgtccaccacgaggatctccaagatgtgaagaacgctgcccaccagaacaag
tttggggaggacatgccccactcacactaa

DBGET integrated database retrieval system