KEGG   Mus musculus (mouse): 15194Help
Entry
15194             CDS       T01002                                 

Gene name
Htt, AI256365, C430023I11Rik, Hd, Hdh, IT15
Definition
(RefSeq) huntingtin
  KO
K04533  
huntingtin
Organism
mmu  Mus musculus (mouse)
Pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    15194 (Htt)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     15194 (Htt)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    15194 (Htt)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    15194 (Htt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 B2; 5 17.92 cM
AA seq 3120 aa AA seqDB search
MATLEKLMKAFESLKSFQQQQQQQPPPQAPPPPPPPPPPQPPQPPPQGQPPPPPPPLPGP
AEEPLHRPKKELSATKKDRVNHCLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSDDAE
SDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQ
KCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLK
SSSPTVRRTAAGSAVSICQHSRRTQYFYNWLLNVLLGLLVPMEEEHSTLLILGVLLTLRC
LVPLLQQQVKDTSLKGSFGVTRKEMEVSPSTEQLVQVYELTLHHTQHQDHNVVTGALELL
QQLFRTPPPELLQALTTPGGLGQLTLVQEEARGRGRSGSIVELLAGGGSSCSPVLSRKQK
GKVLLGEEEALEDDSESRSDVSSSAFAASVKSEIGGELAASSGVSTPGSVGHDIITEQPR
SQHTLQADSVDLSGCDLTSAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISD
SSQTTTEGPDSAVTPSDSSEIVLDGADSQYLGMQIGQPQEDDEEGAAGVLSGEVSDVFRN
SSLALQQAHLLERMGHSRQPSDSSIDKYVTRDEVAEASDPESKPCRIKGDIGQPNDDDSA
PLVHCVRLLSASFLLTGEKKALVPDRDVRVSVKALALSCIGAAVALHPESFFSRLYKVPL
NTTESTEEQYVSDILNYIDHGDPQVRGATAILCGTLVYSILSRSRLRVGDWLGNIRTLTG
NTFSLVDCIPLLQKTLKDESSVTCKLACTAVRHCVLSLCSSSYSDLGLQLLIDMLPLKNS
SYWLVRTELLDTLAEIDFRLVSFLEAKAESLHRGAHHYTGFLKLQERVLNNVVIYLLGDE
DPRVRHVAATSLTRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVST
ITRIYRGYSLLPSITDVTMENNLSRVVAAVSHELITSTTRALTFGCCEALCLLSAAFPVC
TWSLGWHCGVPPLSASDESRKSCTVGMASMILTLLSSAWFPLDLSAHQDALILAGNLLAA
SAPKSLRSSWTSEEEANSAATRQEEIWPALGDRTLVPLVEQLFSHLLKVINICAHVLDDV
TPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASTPMSPKKVGEASAASRQSDTSGPV
TASKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILE
LATLQDIGKCVEEVLGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQ
CRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSA
QLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLR
VNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPK
IIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLI
QYHQVLEMFILVLQQCHKENEDKWKRLSRQVADIILPMLAKQQMHIDSHEALGVLNTLFE
ILAPSSLRPVDMLLRSMFITPSTMASVSTVQLWISGILAILRVLISQSTEDIVLCRIQEL
SFSPHLLSCPVINRLRGGGGNVTLGECSEGKQKSLPEDTFSRFLLQLVGILLEDIVTKQL
KVDMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFTSDGCEGSFYTLESLNA
RVRSMVPTHPALVLLWCQILLLINHTDHRWWAEVQQTPKRHSLSCTKSLNPQKSGEEEDS
GSAAQLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFI
SAIHRNSAASGLFIQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLTLYVDRLLGTP
FRALARMVDTLACRRVEMLLAANLQSSMAQLPEEELNRIQEHLQNSGLAQRHQRLYSLLD
RFRLSTVQDSLSPLPPVTSHPLDGDGHTSLETVSPDKDWYLQLVRSQCWTRSDSALLEGA
ELVNRIPAEDMNDFMMSSEFNLSLLAPCLSLGMSEIANGQKSPLFEAARGVILNRVTSVV
QQLPAVHQVFQPFLPIEPTAYWNKLNDLLGDTTSYQSLTILARALAQYLVVLSKVPAHLH
LPPEKEGDTVKFVVMTVEALSWHLIHEQIPLSLDLQAGLDCCCLALQVPGLWGVLSSPEY
VTHACSLIHCVRFILEAIAVQPGDQLLGPESRSHTPRAVRKEEVDSDIQNLSHVTSACEM
VADMVESLQSVLALGHKRNSTLPSFLTAVLKNIVISLARLPLVNSYTRVPPLVWKLGWSP
KPGGDFGTVFPEIPVEFLQEKEILKEFIYRINTLGWTNRTQFEETWATLLGVLVTQPLVM
EQEESPPEEDTERTQIHVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTR
FGRKLSMIRGIVEQEIQEMVSQRENTATHHSHQAWDPVPSLLPATTGALISHDKLLLQIN
PEREPGNMSYKLGQVSIHSVWLGNNITPLREEEWDEEEEEESDVPAPTSPPVSPVNSRKH
RAGVDIHSCSQFLLELYSRWILPSSAARRTPVILISEVVRSLLVVSDLFTERTQFEMMYL
TLTELRRVHPSEDEILIQYLVPATCKAAAVLGMDKTVAEPVSRLLESTLRSSHLPSQIGA
LHGILYVLECDLLDDTAKQLIPVVSDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLMEN
YPLDVGPEFSASVIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDTESLVKL
SVDRVNVQSPHRAMAALGLMLTCMYTGKEKASPGRASDPSPATPDSESVIVAMERVSVLF
DRIRKGFPCEARVVARILPQFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMATVVYKVFQT
LHSAGQSSMVRDWVMLSLSNFTQRTPVAMAMWSLSCFLVSASTSPWVSAILPHVISRMGK
LEQVDVNLFCLVATDFYRHQIEEEFDRRAFQSVFEVVAAPGSPYHRLLACLQNVHKVTTC
NT seq 9363 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccctggaaaagctgatgaaggctttcgagtcgctcaagtcgtttcagcagcaa
cagcagcagcagccaccgccgcaggcgccgccgccaccgccgccgccgcctccgcctcaa
ccccctcagccgccgcctcaggggcagccgccgccgccaccaccgccgctgccaggtccg
gcagaggaaccgctgcaccgaccaaagaaggaactctcagccaccaagaaagaccgtgtg
aatcattgtctaacaatatgtgaaaacattgtggcacagtctctcagaaattctccagaa
tttcagaaactcttgggcatcgctatggaactgtttctgctgtgcagtgacgatgcggag
tcagatgtcagaatggtggctgatgagtgcctcaacaaagtcatcaaagctttgatggat
tctaatcttccaaggctacagttagaactctataaggaaattaaaaagaatggtgctcct
cgaagtttgcgtgctgccctgtggaggtttgctgagctggctcacctggttcgacctcag
aagtgcaggccttacctggtgaatcttcttccatgcctgacccgaacaagcaaaagaccg
gaggaatcagttcaggagaccttggctgcagctgttcctaaaattatggcttcttttggc
aatttcgcaaatgacaatgaaattaaggttctgttgaaagctttcatagcaaatctgaag
tcaagctctcccaccgtgcggcggacagcagccggctcagccgtgagcatctgccaacat
tctaggaggacacagtacttctacaactggctccttaatgtcctcctaggtctgctggtt
cccatggaagaagagcactccactctcctgatcctcggtgtgttgctcacattgaggtgt
ctagtgcccttgctccagcagcaggtcaaggacacaagtctaaaaggcagctttggggtg
acacggaaagaaatggaagtctctccttctacagagcagcttgtccaggtttatgaactg
actttgcatcatactcagcaccaagaccacaatgtggtgacaggggcactggagctcctg
cagcagctcttccgtacccctccacctgaactcctgcaagcactgaccacaccaggaggg
cttgggcagctcactctggttcaagaagaggcccggggccgaggccgcagcgggagcatc
gtggagcttttagctggagggggttcctcgtgcagccctgtcctctcaagaaagcagaaa
ggcaaagtgctcttaggagaggaagaagccttggaagatgactcggagtccaggtcagat
gtcagcagctcagcctttgcagcctctgtgaagagtgagattggtggagagctcgctgct
tcttcaggtgtttccactcctggttctgttggtcacgacatcatcactgagcagcctaga
tcccagcacacacttcaagcagactctgtggatttgtccggctgtgacctgaccagtgct
gctactgatggggatgaggaggacatcttgagccacagctccagccagttcagtgctgtc
ccatccgaccctgccatggacctgaatgatgggacccaggcctcctcacccatcagtgac
agttctcagaccaccactgaaggacctgattcagctgtgactccttcggacagttctgaa
attgtgttagatggtgccgatagccagtatttaggcatgcagataggacagccacaggag
gacgatgaggagggagctgcaggtgttctttctggtgaagtctcagatgttttcagaaac
tcttctctggcccttcaacaggcacacttgttggaaagaatgggccatagcaggcagcct
tccgacagcagtatagataagtatgtaacaagagatgaggttgctgaagccagtgatcca
gaaagcaagccttgccgaatcaaaggtgacataggacagcctaatgatgatgattctgct
cctctggtacattgtgtccgtcttttatctgcttcctttttgttaactggtgaaaagaaa
gcactggttccagacagagacgtgagagtcagtgtgaaggccctggccctcagctgcatt
ggtgcggctgtggcccttcatccagagtcgttcttcagcagactgtacaaagtacctctt
aataccacggaaagtactgaggaacagtatgtttctgacatcttgaactacatcgatcat
ggagacccacaggtccgaggagctactgccattctctgtgggacccttgtctactccatc
ctcagtaggtcccgtctccgtgttggtgactggctgggcaacatcagaaccctgacagga
aatacattttctctggtggactgcattcctttactgcagaaaacgttgaaggatgaatct
tctgttacttgcaagttggcttgtacagctgtgaggcactgtgtcctgagtctttgcagc
agcagctacagtgacttgggattacaactgcttattgatatgctgcctctgaagaacagc
tcctactggctggtgaggaccgaactgctggacactctggcagagattgacttcaggctc
gtgagttttttggaggcaaaagcagaaagtttacaccgaggggctcatcattatacaggg
tttctaaaactacaagaacgagtactcaataatgtggtcatttatttgcttggagatgaa
gaccccagggttcgacatgttgctgcaacatcattaacaaggcttgtcccaaagctgttt
tacaagtgtgaccaaggacaagctgatccagttgtggctgtagcgagggatcagagcagt
gtctacctgaagctcctcatgcatgagacccagccaccatcacacttttctgtcagcacc
atcaccagaatctatagaggctatagcttactgccaagtataacagatgtcaccatggaa
aacaatctctcaagagttgttgccgcagtttctcatgaactcattacgtcaacaacacgg
gcactcacatttggatgctgtgaagccttgtgtcttctctcagcagcctttccagtttgc
acttggagtttaggatggcactgtggagtgcccccactgagtgcctctgatgagtccagg
aagagctgcactgttgggatggcctccatgattctcaccttgctttcatcagcttggttc
ccactggatctctcagcccatcaggatgccttgattttggctggaaacttgctagcagcg
agtgcccccaagtctctgagaagttcatggacctctgaagaagaagccaactcagcagcc
accagacaggaggaaatctggcctgctctgggggatcggactctagtgcccttggtggag
cagcttttctcccacctgctgaaggtgatcaatatctgtgctcatgtcttggacgatgtg
actcctggaccagcaatcaaggcagccttgccttctctaacaaaccccccttctctaagt
cctattcgacggaaagggaaggagaaagaacctggagaacaagcttctactccaatgagt
cccaagaaagttggtgaggccagtgcagcctctcgacaatcagacacctcaggacctgtc
acagcaagtaaatcatcctcactggggagtttctaccatctcccctcctacctcaaactg
catgatgtcctgaaagccactcacgccaactataaggtcaccttagatcttcagaacagc
actgaaaagtttggggggttcctgcgctctgccttggacgtcctttctcagattctagag
ctggcgacactgcaggacattggaaagtgtgttgaagaggtccttggatacctgaaatcc
tgctttagtcgagaaccaatgatggcaactgtctgtgtgcagcagctattgaagactctc
tttgggacaaacttagcctcacagtttgatggcttatcttccaaccccagcaagtctcag
tgccgagctcagcgccttggctcttcaagtgtgaggcccggcttatatcactactgcttc
atggcaccatacacgcacttcacacaggccttggctgacgcaagcctgaggaacatggtg
caggcggagcaggagcgtgatgcctcggggtggtttgatgtactccagaaagtgtctgcc
caattgaagacgaacctaacaagcgtcacaaagaaccgtgcagataagaatgctattcat
aatcacattaggttatttgagcctcttgttataaaagcattgaagcagtacaccacgaca
acatctgtacaattgcagaagcaggttttggatttgctggcacagctggttcagctacgg
gtcaattactgtctactggattcagaccaggtgttcatcgggtttgtgctgaagcagttt
gagtacattgaagtgggccagttcagggaatcagaggcaattattccaaatatatttttc
ttcctggtattactgtcttatgagcgctaccattcaaaacagatcattggaattcctaaa
atcatccagctgtgtgatggcatcatggccagtggaaggaaggccgttacacatgctata
cctgctctgcagcccattgtccatgacctctttgtgttacgaggaacaaataaagctgat
gcagggaaagagcttgagacacagaaggaggtggtggtctccatgctgttacgactcatc
cagtaccatcaggtgctggagatgttcatccttgtcctgcagcagtgccacaaggagaat
gaggacaagtggaaacggctctctcggcaggtcgcagacatcatcctgcccatgttggcc
aagcagcagatgcatattgactctcatgaagcccttggagtgttaaataccttgtttgag
attttggctccttcctccctacgtcctgtggacatgcttttgcggagtatgttcatcact
ccaagcacaatggcatctgtaagcactgtgcagctgtggatatctggaatcctcgccatt
ctgagggttctcatttcccagtcaaccgaggacattgttctttgtcgtattcaggagctc
tccttctctccacacttgctctcctgtccagtgattaacaggttaaggggtggaggcggt
aatgtaacactaggagaatgcagcgaagggaaacaaaagagtttgccagaagatacattc
tcaaggtttcttttacagctggttggtattcttctagaagacatcgttacaaaacagctc
aaagtggacatgagtgaacagcagcatacgttctactgccaagagctaggcacactgctc
atgtgtctgatccacatattcaaatctggaatgttccggagaatcacagcagctgccact
agactcttcaccagtgatggctgtgaaggcagcttctatactctagagagcctgaatgca
cgggtccgatccatggtgcccacgcacccagccctggtactgctctggtgtcagatccta
cttctcatcaaccacactgaccaccggtggtgggcagaggtgcagcagacacccaagaga
cacagtctgtcctgcacgaagtcacttaacccccagaagtctggcgaagaggaggattct
ggctcggcagctcagctgggaatgtgcaatagagaaatagtgcgaagaggggcccttatt
ctcttctgtgattatgtctgtcagaatctccatgactcagaacacttaacatggctcatt
gtgaatcacattcaagatctgatcagcttgtctcatgagcctccagtacaagactttatt
agtgccattcatcgtaattctgcagctagtggtctttttatccaggcaattcagtctcgc
tgtgaaaatctttcaacgccaaccactctgaagaaaacacttcagtgcttggaaggcatc
catctcagccagtctggtgctgtgctcacactatatgtggacaggctcctgggcaccccc
ttccgtgcgctggctcgcatggtcgacaccctggcctgtcgccgggtagaaatgcttttg
gctgcaaatttacagagcagcatggcccagttgccagaggaggaactaaacagaatccaa
gaacacctccagaacagtgggcttgcacaaagacaccaaaggctctattcactgctggac
agattccgactctctactgtgcaggactcacttagccccttgcccccagtcacttcccac
ccactggatggggatgggcacacatctctggaaacagtgagtccagacaaagactggtac
ctccagcttgtcagatcccagtgttggaccagatcagattctgcactgctggaaggtgca
gagctggtcaaccgtatccctgctgaagatatgaatgacttcatgatgagctcggagttc
aacctaagccttttggctccctgtttaagccttggcatgagcgagattgctaatggccaa
aagagtcccctctttgaagcagcccgtggggtgattctgaaccgggtgaccagtgttgtt
cagcagcttcctgctgtccatcaagtcttccagcccttcctgcctatagagcccacggcc
tactggaacaagttgaatgatctgcttggtgataccacatcataccagtctctgaccata
cttgcccgtgccctggcacagtacctggtggtgctctccaaagtgcctgctcatttgcac
cttcctcctgagaaggagggggacacggtgaagtttgtggtaatgacagttgaggccctg
tcatggcatttgatccatgagcagatcccactgagtctggacctccaagccgggctagac
tgctgctgcctggcactacaggtgcctggcctctggggggtgctgtcctccccagagtac
gtgactcatgcctgctccctcatccattgtgtgcgattcatcctggaagccattgcagta
caacctggagaccagcttctcggtcctgaaagcaggtcacatactccaagagctgtcaga
aaggaggaagtagactcagatatacaaaacctcagtcatgtcacttcggcctgcgagatg
gtggcagacatggtggaatccctgcagtcagtgctggccttgggccacaagaggaacagc
accctgccttcatttctcacagctgtgctgaagaacattgttatcagtctggcccgactc
cccctagttaacagctatactcgtgtgcctcctctggtatggaaactcgggtggtcaccc
aagcctggaggggattttggcacagtgtttcctgagatccctgtagagttcctccaggag
aaggagatcctcaaggagttcatctaccgcatcaacaccctagggtggaccaatcgtacc
cagttcgaagaaacttgggccaccctccttggtgtcctggtgactcagcccctggtgatg
gaacaggaagagagcccaccagaggaagacacagaaagaacccagatccatgtcctggct
gtgcaggccatcacctctctagtgctcagtgcaatgaccgtgcctgtggctggcaatcca
gctgtaagctgcttggagcaacagccccggaacaagccactgaaggctctcgataccaga
tttggaagaaagctgagcatgatcagagggattgtagaacaagaaatccaagagatggtt
tcccagagagagaatactgccactcaccattctcaccaggcgtgggatcctgtcccttct
ctgttaccagctactacaggtgctcttatcagccatgacaagctgctgctgcagatcaac
ccagagcgggagccaggcaacatgagctacaagctgggccaggtgtccatacactccgtg
tggctgggaaataacatcacacccctgagagaggaggaatgggatgaggaagaagaggaa
gaaagtgatgtccctgcaccaacgtcaccacctgtgtctccagtcaattccagaaaacac
cgtgccggggttgatattcactcctgttcgcagtttctgcttgaattgtacagccgatgg
atcctgccatccagtgcagccagaaggacccccgtcatcctgatcagtgaagtggttcga
tctcttcttgtagtgtcagacttattcaccgaacgtacccagtttgaaatgatgtatctg
acgctgacagaactacggagagtgcacccttcagaagatgagatcctcattcagtacctg
gtgcctgccacctgtaaggcagctgctgtccttggaatggacaaaactgtggcagagcca
gtcagccgcctactggagagcacactgaggagcagccacctgcccagccagatcggagcc
ctgcacggcatcctctatgtgttggagtgtgacctcttggatgacactgcaaagcagctc
attccagttgttagtgactatctgctgtccaacctcaaaggaatagcccactgcgtgaac
attcacagccagcagcatgtgctggtaatgtgtgccactgctttctacctgatggaaaac
taccctctggatgtgggaccagaattttcagcatctgtgatacagatgtgtggagtaatg
ctgtctggaagtgaggagtccaccccctccatcatttaccactgtgccctccggggtctg
gagcggctcctgctgtctgagcagctatctcggctagacacagagtccttggtcaagcta
agtgtggacagagtgaatgtacaaagcccacacagggccatggcagccctaggcctgatg
ctcacctgcatgtacacaggaaaggaaaaagccagtccaggcagagcttctgaccccagc
cctgctacacctgacagcgagtctgtgattgtagctatggagcgagtgtctgttctcttt
gataggatccgcaagggatttccctgtgaagccagggttgtggcaaggatcctgcctcag
ttcctagatgacttctttccacctcaagatgtcatgaacaaagtcattggagagttcctg
tccaatcagcagccatacccacagttcatggccactgtagtttacaaggtttttcagact
ctgcacagtgctgggcagtcatccatggtccgggactgggtcatgctgtccctgtccaac
ttcacacaaagaactccagttgccatggccatgtggagcctctcctgcttccttgttagc
gcatctaccagcccatgggtttctgcgatccttccacatgtcatcagcaggatgggcaaa
ctggaacaggtggatgtgaaccttttctgcctggttgccacagacttctacagacaccag
atagaggaggaattcgaccgcagggctttccagtctgtgtttgaggtggtggctgcacca
ggaagtccataccacaggctgcttgcttgtttgcaaaatgttcacaaggtcaccacctgc
tga

DBGET integrated database retrieval system