KEGG   Mus musculus (mouse): 15211Help
Entry
15211             CDS       T01002                                 

Gene name
Hexa, Hex-1
Definition
hexosaminidase A (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mmu  Mus musculus (mouse)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    15211 (Hexa)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    15211 (Hexa)
   00603 Glycosphingolipid biosynthesis - globo series
    15211 (Hexa)
   00604 Glycosphingolipid biosynthesis - ganglio series
    15211 (Hexa)
   00511 Other glycan degradation
    15211 (Hexa)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    15211 (Hexa)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     15211 (Hexa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 B; 9 32.02 cM
AA seq 528 aa AA seqDB search
MAGCRLWVSLLLAAALACLATALWPWPQYIQTYHRRYTLYPNNFQFRYHVSSAAQAGCVV
LDEAFRRYRNLLFGSGSWPRPSFSNKQQTLGKNILVVSVVTAECNEFPNLESVENYTLTI
NDDQCLLASETVWGALRGLETFSQLVWKSAEGTFFINKTKIKDFPRFPHRGVLLDTSRHY
LPLSSILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRKGSFNPVTHIYTAQDVK
EVIEYARLRGIRVLAEFDTPGHTLSWGPGAPGLLTPCYSGSHLSGTFGPVNPSLNSTYDF
MSTLFLEISSVFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGFTDFKQLESFYIQTLLD
IVSDYDKGYVVWQEVFDNKVKVRPDTIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWY
LNRVKYGPDWKDMYKVEPLAFHGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVA
ERLWSSNLTTNIDFAFKRLSHFRCELVRRGIQAQPISVGYCEQEFEQT
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggccggctgcaggctctgggtttcgctgctgctggcggcggcgttggcttgcttggcc
acggcactgtggccgtggccccagtacatccaaacctaccaccggcgctacaccctgtac
cccaacaacttccagttccggtaccatgtcagttcggccgcgcaggcgggctgcgtcgtc
ctcgacgaggcctttcgacgctaccgtaacctgctcttcggttccggctcttggccccga
cccagcttctcaaataaacagcaaacgttggggaagaacattctggtggtctccgtcgtc
acagctgaatgtaatgaatttcctaatttggagtcggtagaaaattacaccctaaccatt
aatgatgaccagtgtttactcgcctctgagactgtctggggcgctctccgaggtctggag
actttcagtcagcttgtttggaaatcagctgagggcacgttctttatcaacaagacaaag
attaaagactttcctcgattccctcaccggggcgtactgctggatacatctcgccattac
ctgccattgtctagcatcctggatacactggatgtcatggcatacaataaattcaacgtg
ttccactggcacttggtggacgactcttccttcccatatgagagcttcactttcccagag
ctcaccagaaaggggtccttcaaccctgtcactcacatctacacagcacaggatgtgaag
gaggtcattgaatacgcaaggcttcggggtatccgtgtgctggcagaatttgacactcct
ggccacactttgtcctgggggccaggtgcccctgggttattaacaccttgctactctggg
tctcatctctctggcacatttggaccggtgaaccccagtctcaacagcacctatgacttc
atgagcacactcttcctggagatcagctcagtcttcccggacttttatctccacctggga
ggggatgaagtcgacttcacctgctggaagtccaaccccaacatccaggccttcatgaag
aaaaagggctttactgacttcaagcagctggagtccttctacatccagacgctgctggac
atcgtctctgattatgacaagggctatgtggtgtggcaggaggtatttgataataaagtg
aaggttcggccagatacaatcatacaggtgtggcgggaagaaatgccagtagagtacatg
ttggagatgcaagatatcaccagggctggcttccgggccctgctgtctgctccctggtac
ctgaaccgtgtaaagtatggccctgactggaaggacatgtacaaagtggagcccctggcg
tttcatggtacgcctgaacagaaggctctggtcattggaggggaggcctgtatgtgggga
gagtatgtggacagcaccaacctggtccccagactctggcccagagcgggtgccgtcgct
gagagactgtggagcagtaacctgacaactaatatagactttgcctttaaacgtttgtcg
catttccgttgtgagctggtgaggagaggaatccaggcccagcccatcagtgtaggctac
tgtgagcaggagtttgagcagacttga

DBGET integrated database retrieval system