KEGG   Mus musculus (mouse): 15258Help
Entry
15258             CDS       T01002                                 

Gene name
Hipk2, 1110014O20Rik, B230339E18Rik, Stank
Definition
(RefSeq) homeodomain interacting protein kinase 2 (EC:2.7.11.1)
  KO
K08826  
homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     15258 (Hipk2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   15258 (Hipk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 B
AA seq 1196 aa AA seqDB search
MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKVEPSSNWDMTGYGSHSKVYSQSKNIPPS
QPASTTVSTSLPIPNPSLPYEQTIIFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTV
SLLDTYQKCGLKRKSEEIENTSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNS
EGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQG
QIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKY
IRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSASHVSKAVCST
YLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLP
AEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVN
MTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRVTPIETLNHPFVTMTHLLDFPHSAH
VKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPTTSS
ATLSLANPEVSILNYQSALYQPSAASMAAVAPRSMPLQTGTAQICARPDPFQQALIVCPP
GFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPGLLAQQAWPGGAQQILLPPAW
QQLTGVATHTSVQHAAVIPETMAGTQQLADWRNTHAHGSHYNPIMQQPALLTGHVTLPAA
QPLNVGVAHVMRQQPTSTTSSRKSKQHQSSVRNVSTCEVTSSQAISSPQRSKRVKENTPP
RCAMVHSSPACSTSVTCGWGDVASSTTRERQRQTIVIPDTPSPTVSVITISSDTDEEEEQ
KHAPTSTVSKQRKNVISCVTVHDSPYSDSSSNTSPYSVQQRTGHNGTNTLDTKGGLENHC
TGNPRTIIVPPLKTQASEVLVECDSLGPAISASHHSSSFKSKSSSTVTSTSGHSSGSSSG
AIAYRQQRPGPHFQQQQPLNLSQAQQHMAADRTGSHRRQQAYITPTMAQAPYTFPHNSPS
HGTVHPHLAAAAHLPTQPHLYTYTAPTALGSTGTVAHLVASQGSARHTVQHTAYPASIVH
QVPVSMGPRVLPSPTIHPSQYPAQFAHQTYISASPASTVYTGYPLSPAKVNQYPYI
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgtgtacgaaggtatggcctcacatgtgcaagttttctcccctcacaccctt
caatcaagtgccttctgtagtgtgaagaaactaaaagtagagccaagttccaactgggac
atgactgggtacggctcccacagcaaagtgtacagccagagcaagaacataccaccttct
cagccagcctccacaaccgtcagcacctccttgccaatccccaacccaagcctaccttac
gagcagaccatcatcttcccaggaagtactggacacatagttgtaacatcagcaagtagc
acttctgtcaccgggcaagtcctcggtggaccacataacctaatgcgtcgaagcactgtg
agcctccttgacacctaccaaaaatgtggactcaagcgcaagagtgaggagattgagaac
acaagcagcgtgcagatcattgaagagcatccacccatgattcagaataatgccagcggg
gccactgtagccactgccaccacatccactgccacctccaaaaacagtggctccaacagt
gaaggggactatcagctggtgcagcatgaagtactgtgctccatgaccaacacctatgag
gttttagagttcttggggcgagggacatttgggcaagtggtcaagtgctggaaacggggc
accaatgaaattgtggccattaagatcctcaagaaccacccctcctatgcccggcaaggc
cagattgaagtgagcatcttggcccggctgagcacggagagcgctgatgactacaatttt
gtgcgggcctatgagtgcttccagcacaagaaccacacgtgcttagtctttgagatgttg
gagcagaacctttatgactttctgaaacagaacaagtttagtcccttgcccctcaagtat
attcgcccagtcctccagcaggtagccacagccctgatgaaactcaaaagcctgggtctt
atccatgctgacctcaaaccagaaaacatcatgctggtggatccatccagacaaccgtac
cgagtgaaggtcattgactttggttcagctagtcatgtgtccaaagctgtctgctctacg
tacttgcaatccagatactaccgggcccctgagatcatccttggtttgccattctgtgag
gcaattgacatgtggtcccttggttgtgtcattgctgaactgttcctgggctggccatta
tacccaggtgcttctgagtatgatcagattcggtatatttcacaaacacagggtttacca
gctgaatatttattaagtgcagggacaaagacaactaggtttttcaaccgtgacacagac
tcaccgtatcctttgtggaggctaaagacaccagatgaccatgaagcagagacgggaatt
aagtcaaaggaagcaagaaagtacattttcaactgtttggatgatatggcccaggtgaac
atgacaacagatttggaagggagtgacatgttagtagagaaggcagaccgacgggagttc
attgacctgttaaagaagatgctgaccatcgatgctgataagagagtcactcccattgaa
actctgaaccacccctttgtcaccatgacacacctgcttgacttcccccatagtgcccat
gtcaaatcttgtttccaaaacatggagatttgcaagcgccgggtgaatatgtatgacaca
gtgaaccagagcaaaacacctttcatcactcacgtggcccccagcacatccaccaacttg
accatgacctttaacaaccagctgaccactgtccacaaccaggctcccaccacctccagt
gccactctttccttagccaatcccgaagtctccatactaaactaccaatctgcactctac
cagccctcagcggcatccatggccgcggtggccccgcggagcatgcccctgcagacggga
acagcccaaatttgtgcccgacctgatcccttccagcaagctctcatcgtgtgtccccct
ggcttccaaggcctgcaggcctctccctccaagcacgctggctactcagtgcggatggaa
aatgctgtccccatcgtcacccaggcgccaggagctcagcctcttcagatccaaccaggc
ctgcttgctcagcaggcctggccaggtggggcccaacagatcctacttcctccagcatgg
cagcagctgactggcgtggccacccacacatctgtacagcatgcagctgtgattcctgag
accatggcaggcactcagcaactggctgactggaggaacacgcatgctcatggaagtcat
tacaatcccatcatgcagcagcctgcactcttgactggtcatgtgacccttccagctgcc
cagcccttaaatgtgggtgtagcccatgtgatgaggcaacaaccaaccagcaccacctcc
tccaggaagagtaagcagcaccagtcatctgtgagaaatgtctccacctgtgaggtgacc
tcttcacaggctatcagctcccctcagcgatccaagcgtgtcaaggagaacactccccca
cggtgcgccatggtacacagcagcccagcttgcagcacctcagtcacctgtgggtggggc
gacgtggcctccagcaccacccgggagcgacagcggcagacgattgtcatccccgacacc
ccgagccccacagtcagtgtcatcaccatcagcagtgacaccgatgaagaagaggagcag
aagcacgcccccaccagcacagtctccaagcaaagaaaaaatgtcatcagctgtgtcacc
gtccacgactctccctactctgactcctccagcaacaccagcccctactcggtgcagcag
cgcacagggcacaacggcaccaacaccttggacaccaaggggggcctagagaatcactgc
actggcaacccccgcaccatcatcgtacccccactgaagacccaggccagtgaagtgttg
gtagaatgtgacagcctagggccagcgatcagtgccagtcaccattcgtcctccttcaag
tccaagtcctccagcaccgtgacctccaccagtggacactcttcagggagctcttcagga
gccatcgcctaccgtcagcagcggccaggcccccacttccagcagcagcagcccctcaat
ctcagccaggcccagcagcacatggctgcggaccgcaccgggagtcaccgtcgacagcag
gcctacatcactccgaccatggcgcaagctccgtacaccttcccgcacaacagccccagc
catggcactgttcacccccacctggctgcggctgcccacctccccacccagcctcacctc
tacacctatacagcgcccacagccctaggctccaccggcactgtagcccacctggtggca
tcccaaggctcagcacgccacaccgtgcagcacactgcctatccggccagcatcgtccac
caggtccctgtgagcatggggccccgggtcctgccctcgcccaccatccaccccagtcag
tatccagcccagtttgcccaccagacctatatcagcgcctcgccagcctccaccgtctac
actggatacccactgagtcctgccaaggtcaaccaatacccttacatataa

DBGET integrated database retrieval system