KEGG   Mus musculus (mouse): 15382Help
Entry
15382             CDS       T01002                                 

Gene name
Hnrnpa1, HDP-1, Hdp, Hnrpa1, hnRNP_A1, hnrnp-A1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A1
  KO
K12741  
heterogeneous nuclear ribonucleoprotein A1/A3
Organism
mmu  Mus musculus (mouse)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    15382 (Hnrnpa1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     15382 (Hnrnpa1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     15382 (Hnrnpa1)
Spliceosome [BR:mmu03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    15382 (Hnrnpa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 F3; 15 58.58 cM
AA seq 320 aa AA seqDB search
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS
GDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPR
NQGGYGGSSSSSSYGSGRRF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtccgagtctcccaaggagccagaacagctgcggaagctcttcatcggaggg
ctgagcttcgaaacaaccgacgagagtctgaggagccattttgagcaatggggaacacta
acagactgtgtggtaatgagagatccaaacaccaagagatccaggggctttgggtttgtc
acatatgccactgtggaagaagtggatgctgccatgaatgcaagaccacacaaggtggat
ggaagagttgtggaacctaagagagctgtctcaagagaagattctcagcgaccaggtgcc
cacttaactgtgaaaaagatctttgttggtggtattaaagaagacactgaagaacatcac
ctacgagattattttgagcagtatgggaagattgaagtgatagaaattatgactgacaga
ggcagtgggaaaaagaggggctttgcttttgttacctttgatgaccatgactctgtggat
aagattgttattcagaaataccatactgtgaatggccacaactgtgaagtaagaaaggct
ctgtcgaagcaagagatggctagtgcttcatccagtcagagaggtcgcagtggttctgga
aactttggtggtggtcgtggaggcggttttggtggcaatgacaattttggtcgaggaggg
aacttcagtggtcgtggtggctttggtggcagccgtggtggtggtggatatggtggcagt
ggggatggctataatggatttggcaatgatggaagcaattttggaggtggtggaagctac
aatgattttggcaattacaacaatcagtcttccaattttgggccgatgaagggaggaaac
tttggaggcaggagctctggcccttatggtggtggaggccagtactttgctaaaccacgg
aaccaaggtggctatggcggttccagcagcagcagtagctatggcagtggcaggaggttc
taa

DBGET integrated database retrieval system