KEGG   Mus musculus (mouse): 15445Help
Entry
15445             CDS       T01002                                 

Gene name
Hpd, Fla, Flp, Hppd, Laf
Definition
(RefSeq) 4-hydroxyphenylpyruvic acid dioxygenase (EC:1.13.11.27)
  KO
K00457  
4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
mmu  Mus musculus (mouse)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Metabolic pathways
Module
Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    15445 (Hpd)
   00360 Phenylalanine metabolism
    15445 (Hpd)
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    15445 (Hpd)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     15445 (Hpd)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   15445 (Hpd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 F; 5 62.82 cM
AA seq 393 aa AA seqDB search
MTTYNNKGPKPERGRFLHFHSVTFWVGNAKQAASFYCNKMGFEPLAYRGLETGSREVVSH
VIKQGKIVFVLCSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDHIVQKARERGAKIVRE
PWVEQDKFGKVKFAVLQTYGDTTHTLVEKINYTGRFLPGFEAPTYKDTLLPKLPRCNLEI
IDHIVGNQPDQEMQSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVTNYEESIKMPI
NEPAPGRKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGTEFLAAPSSYYKLLR
ENLKSAKIQVKESMDVLEELHILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFG
AGNFNSLFKAFEEEQALRGNLTDLEPNGVRSGM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctacaacaacaaaggaccaaagcctgagagaggccggttcctccatttccac
tcggtgaccttctgggttggcaatgccaagcaggctgcttccttctactgcaacaagatg
ggctttgaacctctggcctacaggggcctagagactggctcccgggaggtagtcagccac
gtcatcaagcaagggaaaattgtgtttgttctctgctctgctctcaatccctggaacaaa
gagatgggcgaccacttggtgaagcatggcgacggggtgaaagacatcgcattcgaggtg
gaagactgcgaccacattgtgcagaaagctcgagaacggggcgccaaaattgtgcgggag
ccatgggtggagcaagacaaatttgggaaggtgaagtttgctgtgctgcagacgtatgga
gataccacacacaccctggtggagaagatcaactacactggccgtttcttacctggattc
gaggccccaacatacaaggataccctgcttccaaaactacccagatgtaaccttgagatc
attgaccacattgtaggcaaccaacccgaccaagaaatgcagtctgcctcagaatggtac
ctgaaaaacctgcagttccaccggttctggtccgtggacgacacgcaggtgcacacggag
tacagctctctgcgctccattgtggtgaccaactacgaggaatccatcaaaatgcccatc
aacgagccagctccgggcaggaagaagtctcagatccaggaatatgtggactataatggg
ggtgctggggtccagcacatcgctctcaagacggaagacatcatcacagcaatccgccac
ttgagggagcgaggcacggagttcttggccgccccatcttcttactacaaactgcttcgg
gagaatctcaagtcagccaagatccaggtgaaagagagcatggacgtcctggaggagctg
catatcctagtcgactatgacgagaaaggctacctcctacagatcttcaccaagcccatg
caggaccggcccacactcttcctggaagtcattcaacgtcacaaccaccagggctttgga
gcgggcaacttcaactctctgttcaaggcgttcgaggaggagcaagccctacggggcaac
ctcactgacctggagcccaatggtgtgaggtctggaatgtaa

DBGET integrated database retrieval system