KEGG   Mus musculus (mouse): 15446Help
Entry
15446             CDS       T01002                                 

Gene name
Hpgd, 15-PGDH, AV026552
Definition
(RefSeq) hydroxyprostaglandin dehydrogenase 15 (NAD)
  KO
K00069  
15-hydroxyprostaglandin dehydrogenase (NAD) [EC:1.1.1.141]
Organism
mmu  Mus musculus (mouse)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    15446 (Hpgd)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.141  15-hydroxyprostaglandin dehydrogenase (NAD+)
     15446 (Hpgd)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   15446 (Hpgd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8; 8 B3.2
AA seq 269 aa AA seqDB search
MHVNGKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKCKAALDEQFEPQKTLF
VQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLD
YMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNV
ICPGFVDTPILESIEKEENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNG
AIMKITASKGIHFQDYDISPLLVKAPLTS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgaacggcaaagtggctctggtgaccggcgcggcacagggcataggcaaagcc
ttcgctgaggctctgctgctccatggcgccaaggtagcattggtggattggaatcttgag
gcaggtgtaaaatgtaaagctgccctagatgagcagttcgaacctcagaagacactgttc
gtccagtgtgatgtggctgaccagaaacaactgagagatacttttagaaaagttgtagac
catttcggaagattggatattttggtcaacaatgcaggcgtgaacaatgagaaaaactgg
gaacagactctacaaattaatttggtttctgttatcagtgggacctatcttggtttggat
tacatgagtaagcaaaacggaggtgaaggcggcatcatcatcaatatgtcttcattagca
gggctcatgcctgttgcgcagcaacctgtttattgtgcttcgaagcacggcatcatcgga
ttcacacgctcagcagcgatggctgctaacctcatgaaaagcggtgtaagactgaatgtc
atttgcccaggctttgtggacacacccatccttgaatccattgaaaaagaagaaaatatg
ggccaatatatagaatataaggaccagatcaaggctatgatgaaattctatggggtttta
cacccatcaaccattgccaatggattaataaatctcattgaagatgatgctctcaatggt
gccattatgaagatcacggcatcgaaaggaattcattttcaagattatgacatctctcca
ttactcgtaaaagctccattaacctcctaa

DBGET integrated database retrieval system