KEGG   Mus musculus (mouse): 15466Help
Entry
15466             CDS       T01002                                 

Gene name
Hrh2, H2R, HH2R
Definition
(RefSeq) histamine receptor H2
  KO
K04150  histamine receptor H2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    15466 (Hrh2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15466 (Hrh2)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    15466 (Hrh2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Histamine [OT]
    15466 (Hrh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 15466
NCBI-ProteinID: NP_001010973
MGI: 108482
Ensembl: ENSMUSG00000034987
Vega: OTTMUSG00000034187
UniProt: P97292
Position
13 B1; 13 28.4 cM
AA seq 397 aa AA seqDB search
MEPNGTVHSCCLDSIALKVTISVVLTTLIFITVAGNVVVCLAVSLNRRLRSLTNCFIVSL
AATDLLLGLLVMPFSAIYQLSFKWSFGQVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV
YGLVDGMVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG
AFIVCWFPYFTAFVYRGLRGDDAVNEVVEGIVLWLGYANSALNPILYATLNRDFRMAYQQ
LFHCKLASHNSHKTSLRLNNSLLSRSQSREGRWQEEKPLKLQVWSGTELTHPQGSPVRTR
LSHSSCLLSLSLLSFIWKLGTWIHHRRPFQPSLHISA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaatggcacggttcattcctgctgtttggactctattgcattgaaagtcacc
atcagtgtggtcctcaccaccctcatcttcatcactgttgctggcaatgtggtcgtctgc
ctggctgtcagcttgaatcgtcggctccgcagtctgaccaattgcttcattgtgtccctg
gcagccactgacctgcttcttggcctcctggtgatgcccttctctgccatttaccagttg
tccttcaagtggagctttggccaggtcttctgcaacatctacaccagcctggatgtgatg
ctctgcacagcttccatcctcaacctcttcatgatcagcttggaccgctactgcgctgtc
acggacccactgcggtaccccgtgttggtcacccctgttcgcgttgccatctctttggtc
tttatttgggtcatttccatcaccctctccttcctctctattcacctaggatggaacagc
agaaatgggaccagagggggcaatgacaccttcaagtgcaaagtgcaggtcaacgaggta
tatggactggtggatgggatggtcaccttctacctgcctcttctcatcatgtgtgtcacc
tactacagaatctttaagatcgccagggagcaagccaagaggatcaaccacatcagctcc
tggaaggcagccaccatcagagaacacaaagccaccgtgaccctggctgccgtcatggga
gcattcatcgtctgctggtttccttacttcactgccttcgtttaccgtggactgagaggg
gatgacgctgtgaacgaggtggtcgagggtatcgtcctatggttgggttatgccaattca
gccctgaaccccatcctgtacgccaccctcaacagagacttccgcatggcgtaccaacag
ctcttccactgcaagcttgcaagccacaactctcacaaaacttccctgaggttgaacaac
tctctgctgtccaggagccaaagccgagaaggtagatggcaggaggagaagcccctgaag
cttcaggtgtggagtgggacagaactcacacacccccagggaagcccagtcaggacacga
ctgagtcactcaagttgtctcctgagcctgagcctcctgtccttcatctggaagctggga
acttggattcatcacaggagacccttccaaccatcactacatatcagtgcttaa

DBGET integrated database retrieval system