KEGG   Mus musculus (mouse): 15466Help
Entry
15466             CDS       T01002                                 

Gene name
Hrh2
Definition
histamine receptor H2
Orthology
K04150  
histamine receptor H2
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    15466 (Hrh2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15466 (Hrh2)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    15466 (Hrh2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Histamine [OT]
    15466 (Hrh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 B1; 13 28.4 cM
AA seq 397 aa AA seqDB search
MEPNGTVHSCCLDSIALKVTISVVLTTLIFITVAGNVVVCLAVSLNRRLRSLTNCFIVSL
AATDLLLGLLVMPFSAIYQLSFKWSFGQVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV
YGLVDGMVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG
AFIVCWFPYFTAFVYRGLRGDDAVNEVVEGIVLWLGYANSALNPILYATLNRDFRMAYQQ
LFHCKLASHNSHKTSLRLNNSLLSRSQSREGRWQEEKPLKLQVWSGTELTHPQGSPVRTR
LSHSSCLLSLSLLSFIWKLGTWIHHRRPFQPSLHISA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaatggcacggttcattcctgctgtttggactctattgcattgaaagtcacc
atcagtgtggtcctcaccaccctcatcttcatcactgttgctggcaatgtggtcgtctgc
ctggctgtcagcttgaatcgtcggctccgcagtctgaccaattgcttcattgtgtccctg
gcagccactgacctgcttcttggcctcctggtgatgcccttctctgccatttaccagttg
tccttcaagtggagctttggccaggtcttctgcaacatctacaccagcctggatgtgatg
ctctgcacagcttccatcctcaacctcttcatgatcagcttggaccgctactgcgctgtc
acggacccactgcggtaccccgtgttggtcacccctgttcgcgttgccatctctttggtc
tttatttgggtcatttccatcaccctctccttcctctctattcacctaggatggaacagc
agaaatgggaccagagggggcaatgacaccttcaagtgcaaagtgcaggtcaacgaggta
tatggactggtggatgggatggtcaccttctacctgcctcttctcatcatgtgtgtcacc
tactacagaatctttaagatcgccagggagcaagccaagaggatcaaccacatcagctcc
tggaaggcagccaccatcagagaacacaaagccaccgtgaccctggctgccgtcatggga
gcattcatcgtctgctggtttccttacttcactgccttcgtttaccgtggactgagaggg
gatgacgctgtgaacgaggtggtcgagggtatcgtcctatggttgggttatgccaattca
gccctgaaccccatcctgtacgccaccctcaacagagacttccgcatggcgtaccaacag
ctcttccactgcaagcttgcaagccacaactctcacaaaacttccctgaggttgaacaac
tctctgctgtccaggagccaaagccgagaaggtagatggcaggaggagaagcccctgaag
cttcaggtgtggagtgggacagaactcacacacccccagggaagcccagtcaggacacga
ctgagtcactcaagttgtctcctgagcctgagcctcctgtccttcatctggaagctggga
acttggattcatcacaggagacccttccaaccatcactacatatcagtgcttaa

DBGET integrated database retrieval system