KEGG   Mus musculus (mouse): 15466Help
Entry
15466             CDS       T01002                                 

Gene name
Hrh2
Definition
histamine receptor H2
Orthology
K04150  
histamine receptor H2
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gastric acid secretion
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mmu04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mmu04080]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:mmu04971]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 B1; 13 28.4 cM
AA seq 397 aa AA seqDB search
MEPNGTVHSCCLDSIALKVTISVVLTTLIFITVAGNVVVCLAVSLNRRLRSLTNCFIVSL
AATDLLLGLLVMPFSAIYQLSFKWSFGQVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV
YGLVDGMVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG
AFIVCWFPYFTAFVYRGLRGDDAVNEVVEGIVLWLGYANSALNPILYATLNRDFRMAYQQ
LFHCKLASHNSHKTSLRLNNSLLSRSQSREGRWQEEKPLKLQVWSGTELTHPQGSPVRTR
LSHSSCLLSLSLLSFIWKLGTWIHHRRPFQPSLHISA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaatggcacggttcattcctgctgtttggactctattgcattgaaagtcacc
atcagtgtggtcctcaccaccctcatcttcatcactgttgctggcaatgtggtcgtctgc
ctggctgtcagcttgaatcgtcggctccgcagtctgaccaattgcttcattgtgtccctg
gcagccactgacctgcttcttggcctcctggtgatgcccttctctgccatttaccagttg
tccttcaagtggagctttggccaggtcttctgcaacatctacaccagcctggatgtgatg
ctctgcacagcttccatcctcaacctcttcatgatcagcttggaccgctactgcgctgtc
acggacccactgcggtaccccgtgttggtcacccctgttcgcgttgccatctctttggtc
tttatttgggtcatttccatcaccctctccttcctctctattcacctaggatggaacagc
agaaatgggaccagagggggcaatgacaccttcaagtgcaaagtgcaggtcaacgaggta
tatggactggtggatgggatggtcaccttctacctgcctcttctcatcatgtgtgtcacc
tactacagaatctttaagatcgccagggagcaagccaagaggatcaaccacatcagctcc
tggaaggcagccaccatcagagaacacaaagccaccgtgaccctggctgccgtcatggga
gcattcatcgtctgctggtttccttacttcactgccttcgtttaccgtggactgagaggg
gatgacgctgtgaacgaggtggtcgagggtatcgtcctatggttgggttatgccaattca
gccctgaaccccatcctgtacgccaccctcaacagagacttccgcatggcgtaccaacag
ctcttccactgcaagcttgcaagccacaactctcacaaaacttccctgaggttgaacaac
tctctgctgtccaggagccaaagccgagaaggtagatggcaggaggagaagcccctgaag
cttcaggtgtggagtgggacagaactcacacacccccagggaagcccagtcaggacacga
ctgagtcactcaagttgtctcctgagcctgagcctcctgtccttcatctggaagctggga
acttggattcatcacaggagacccttccaaccatcactacatatcagtgcttaa

DBGET integrated database retrieval system