KEGG   Mus musculus (mouse): 15481Help
Entry
15481             CDS       T01002                                 

Gene name
Hspa8, 2410008N15Rik, Hsc70, Hsc71, Hsc73, Hsp73, Hspa10
Definition
(RefSeq) heat shock protein 8
  KO
K03283  
heat shock 70kDa protein 1/8
Organism
mmu  Mus musculus (mouse)
Pathway
Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Longevity regulating pathway - multiple species
Antigen processing and presentation
Estrogen signaling pathway
Legionellosis
Toxoplasmosis
Measles
Influenza A
Epstein-Barr virus infection
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    15481 (Hspa8)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15481 (Hspa8)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    15481 (Hspa8)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    15481 (Hspa8)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    15481 (Hspa8)
  Endocrine system
   04915 Estrogen signaling pathway
    15481 (Hspa8)
  Aging
   04213 Longevity regulating pathway - multiple species
    15481 (Hspa8)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    15481 (Hspa8)
   05162 Measles
    15481 (Hspa8)
   05164 Influenza A
    15481 (Hspa8)
   05169 Epstein-Barr virus infection
    15481 (Hspa8)
   05145 Toxoplasmosis
    15481 (Hspa8)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15481 (Hspa8)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19 complex
    15481 (Hspa8)
 Complex C
   Prp19-CDC5 complex
    15481 (Hspa8)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    15481 (Hspa8)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   15481 (Hspa8)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15481 (Hspa8)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    15481 (Hspa8)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   15481 (Hspa8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15481 (Hspa8)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    CHL1; L1 cell adhesion molecule like protein [KO:K06758]
     15481 (Hspa8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 A5.1; 9 21.55 cM
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggacctgcagttggcattgatctcggcaccacctactcctgtgtgggtgtc
ttccagcatggaaaggtggaaattattgccaatgaccagggtaaccgcaccacgccaagc
tatgttgctttcacggacacagagagattaattggggatgcggccaagaatcaggttgca
atgaaccccaccaacacagtttttgatgccaaacgtctgatcgggcgtaggtttgatgat
gctgttgttcagtctgatatgaagcactggcccttcatggtggtgaatgatgcaggcagg
cccaaggtccaagtggaatacaaaggggagacaaaaagtttctacccagaggaagtgtcc
tccatggttctgacaaagatgaaggaaattgcagaagcgtacctcggaaagaccgttacc
aacgctgtggtcacagtgcccgcttacttcaatgactctcagcgacaggcaacaaaagat
gctggaactattgctggcctcaatgtacttcgaatcatcaatgaaccaactgctgctgct
attgcttacggcttagataagaaggtcggagctgaaaggaatgtgctcatttttgacttg
ggaggtggcacttttgatgtgtcaatcctcactattgaggatggaatttttgaggtcaaa
tcaacagctggagacacccacttaggtggagaagattttgacaaccgaatggtcaatcat
ttcattgctgagttcaagcgaaagcacaagaaagacatcagtgagaacaagagagctgtc
cgccgtctccgcacggcctgcgagcgggccaagcgcaccctctcctccagcacccaggcc
agtattgagattgattctctctatgagggaattgacttctatacctccattacccgggct
cgatttgaggagttgaatgctgacctgttccgtggcacactggaccctgtagagaaggcc
cttcgagatgccaagctggacaagtcacagatccatgatattgtcttggtgggtggttct
accagaatccccaagattcagaaacttctgcaagacttcttcaatggaaaagagctgaac
aagagcattaaccccgatgaagctgttgcctatggtgcagctgtccaggcagccattcta
tctggagacaagtctgagaacgttcaggatttgctgctcttggatgtcactcctctttcc
cttggtattgaaactgctggcggagtcatgactgtcctcatcaagcgcaataccaccatc
cccaccaagcagacacagactttcaccacctactctgacaaccagcctggtgtactcatt
caggtgtatgaaggtgaaagggccatgaccaaggacaacaacctgcttggaaagttcgag
ctcacaggcatccctccagcaccccgtggggtccctcagattgaggttacttttgacatc
gatgccaatggcatcctcaatgtttctgctgtagataagagcacaggaaaggagaacaag
atcaccatcaccaatgacaagggccgcttgagtaaggaagatattgagcgcatggtccaa
gaagctgagaagtacaaggctgaggatgagaagcagagagataaggtttcctccaagaac
tcactggagtcctatgccttcaacatgaaagcaactgtggaagatgagaaacttcaaggc
aagatcaatgatgaggacaaacagaagattcttgacaagtgcaatgaaatcatcagctgg
ctggataagaaccagactgcagagaaggaagaatttgagcatcagcagaaagaactggag
aaagtctgcaaccctatcattaccaagctgtaccagagtgcaggtggcatgcctggggga
atgcctggtggcttcccaggtggaggagctcccccatctggtggtgcttcttcaggcccc
accattgaagaggtggattaa

DBGET integrated database retrieval system