KEGG   Mus musculus (mouse): 15505Help
Entry
15505             CDS       T01002                                 

Gene name
Hsph1, 105kDa, AI790491, Hsp105, Hsp110, hsp-E7I, hsp110/105
Definition
(RefSeq) heat shock 105kDa/110kDa protein 1
  KO
K09485  heat shock protein 110kDa
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15505 (Hsph1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP110
   15505 (Hsph1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C HBM
Motif
Other DBs
NCBI-GeneID: 15505
NCBI-ProteinID: NP_038587
MGI: 105053
Ensembl: ENSMUSG00000029657
Vega: OTTMUSG00000021374
UniProt: Q61699
Position
5 G3; 5 89.18 cM
AA seq 858 aa AA seqDB search
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHA
NNTVSSFKRFHGRAFNDPFIQKEKENLSYDLVPMKNGGVGIKVMYMDEEHFFSVEQITAM
LLTKLKETAENNLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALN
YGIYKQDLPNAEEKPRVVVFVDMGHSSFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKL
VEHFCAEFKTKYKLDAKSKIRALLRLHQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGK
MNRSQFEELCAELLQKIEVPLHSLMAQTQLKAEDVSAIEIVGGATRIPAVKERIAKFFGK
DVSTTLNADEAVARGCALQCAILSPAFKVREFSVTDAVPFPISLVWNHDSEETEGVHEVF
SRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIGRFVVQNVSAQKDGEKSRVKV
KVRVNTHGIFTISTASMVEKVPTEEEDGSSLEADMECPNQRPTESSDVDKNIQQDNSEAG
TQPQVQTDGQQTSQSPPSPELTSEESKTPDADKANEKKVDQPPEAKKPKIKVVNVELPVE
ANLVWQLGRDLLNMYIETEGKMIMQDKLEKERNDAKNAVEECVYEFRDKLCGPYEKFICE
QEHEKFLRLLTETEDWLYEEGEDQAKQAYIDKLEELMKMGTPVKVRFQEAEERPKVLEEL
GQRLQHYAKIAADFRGKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKRSLDQDPV
VRTHEIRAKVKELNNVCEPVVTQPKPKIESPKLERTPNGPNIDKKEDLEGKNNLGAEAPH
QNGECHPNEKGSVNMDLD
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggttgggctagacgtaggctcacagagctgctacattgcggtggcgcgggcc
gggggcatcgagaccatcgccaacgagttcagcgaccgctgcaccccgtcagtcatatca
tttggatcaaaaaacagaacaattggagttgcagccaaaaaccagcaaatcactcatgca
aacaatacggtctctagctttaagagatttcatggcagagcattcaatgaccccttcatt
cagaaggaaaaggagaacctgagctatgatttggtcccaatgaaaaatggtggcgtggga
ataaaggtcatgtacatggatgaagaacatttcttcagtgtggagcagataacagccatg
ctgctgactaagttaaaggaaactgcagaaaacaacctcaagaagccagtgacagactgt
gtcatctcagtcccatccttcttcacagatgctgagcgaaggtctgtgctggatgctgcg
cagattgtgggcttgaactgcttgcggctcatgaatgacatgacggctgttgctttgaat
tatgggatttataagcaagatctcccgaatgccgaggagaagccacgggtggtggtgttt
gttgacatgggacactcatctttccaagtgtctgcctgtgcttttaacaaaggaaaactg
aaggttctaggcacagcttttgatcccttcttaggaggaaagaactttgatgagaagcta
gtagaacatttttgtgctgaatttaaaaccaagtacaaattggatgcaaaatccaaaatt
cgagccctccttcgtctccatcaggagtgtgaaaagttgaaaaagctcatgagttctaac
agcacggacctgccgctgaacatcgagtgctttatgaatgacaaggatgtctctgggaag
atgaacaggtcacagtttgaagaactgtgtgctgagctcctgcaaaaaatagaggtcccc
cttcactcgttgatggcacagactcagctcaaggctgaagatgtgagtgccattgagata
gtgggaggtgccacaagaatcccagctgtgaaagaaagaattgccaagttctttggaaaa
gatgtcagcaccacgctcaatgcagacgaagctgtggccagaggctgtgcactgcagtgt
gcaattctttctccggcatttaaagttagagagttctctgtcaccgatgcagttcctttt
ccaatatctctggtctggaaccacgactcggaagaaacggaaggtgtgcacgaggtgttc
agtcggaaccatgctgctcctttctccaaagtgctcaccttcctgagaagggggcccttt
gagctagaagctttctattctgaccctcaaggagttccatatccagaagcaaaaataggc
cgttttgttgttcagaatgtttctgcacagaaagatggagagaagtcgagagtgaaggtc
aaagtgcgtgtgaacacacatggcatcttcaccatctccacggcttccatggtggagaag
gtcccgaccgaggaagaggatggctcctctctcgaggcagacatggaatgtccaaaccag
aggccaacagaaagctcggatgtggataaaaatatccagcaagacaacagtgaagctgga
acacagccccaggtacaaactgatggtcaacaaacctcacagtctcccccttcacctgaa
cttacctcagaagaaagcaaaaccccagatgctgacaaagcaaatgaaaagaaagttgat
cagcctccagaagccaagaaacctaaaataaaggtggtaaatgttgagctgcctgtagaa
gccaacttggtatggcagttagggagagaccttcttaacatgtatattgagacagagggc
aagatgatcatgcaagacaagctggagaaggagcggaacgacgccaagaacgccgtggag
gagtgtgtatatgagttcagggacaagctatgtggaccatatgagaaattcatatgtgag
caggaacatgagaagttcttgaggcttctaacagagacggaagactggctgtatgaggaa
ggggaggaccaggctaagcaggcatacattgacaagttggaagagctgatgaaaatgggc
actcctgttaaagtcagatttcaagaagctgaggaacgaccgaaagtgttggaggagctg
gggcagcgcctgcagcactatgccaagattgcagcggacttcagaggcaaggatgagaaa
tacaaccacattgatgaatcagaaatgaagaaggttgagaagtctgttaatgaggtgatg
gagtggatgaataatgtcatgaatgctcaggctaaaagaagtcttgatcaagaccctgtt
gttcgaactcatgaaatcagagcgaaggtcaaggaattgaacaatgtttgtgaacctgtt
gtaactcaacccaaaccaaaaatcgagtcacctaaactggagagaactccaaatggccca
aatattgacaagaaagaagatttagaaggcaaaaataatcttggtgctgaagctccgcat
cagaatggtgaatgccaccctaatgagaagggctctgtcaacatggacctggactag

DBGET integrated database retrieval system