KEGG   Mus musculus (mouse): 15507Help
Entry
15507             CDS       T01002                                 

Gene name
Hspb1, 27kDa, Hsp25
Definition
(RefSeq) heat shock protein 1
  KO
K04455  
heat shock protein beta-1
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
VEGF signaling pathway
Amoebiasis
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    15507 (Hspb1)
   04370 VEGF signaling pathway
    15507 (Hspb1)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    15507 (Hspb1)
   05146 Amoebiasis
    15507 (Hspb1)
Spliceosome [BR:mmu03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    15507 (Hspb1)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    15507 (Hspb1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP20
   15507 (Hspb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   15507 (Hspb1)
  Exosomal proteins of breast cancer cells
   15507 (Hspb1)
  Exosomal proteins of bladder cancer cells
   15507 (Hspb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5 75.51 cM
AA seq 209 aa AA seqDB search
MTERRVPFSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRLPDEWSQWFSAAGWPGYVRPLP
AATAEGPAAVTLAAPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEG
VVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQS
AEITIPVTFEARAQIGGPEAGKSEQSGAK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgccgcgtgcccttctcgctgctgcggagcccgagctgggaaccattccgg
gactggtaccctgcacacagccgcctcttcgatcaagctttcggggtgccccggttgccc
gatgagtggtcgcagtggttcagcgccgctgggtggcccggatacgtgcgcccgctgccc
gccgcgaccgccgagggccccgcggcggtgaccctggccgcaccagccttcagccgagcg
ctcaaccgacagctcagcagcggggtctcggagatccgacagacggctgatcgctggcgc
gtgtccctggacgtcaaccacttcgctccggaggagctcacagtgaagaccaaggaaggc
gtggtggagatcactggcaagcacgaagaaaggcaggacgaacatggctacatctctcgg
tgcttcacccggaaatacacgctccctccaggtgtggaccccaccctagtgtcctcttcc
ctatcccctgagggcacacttaccgtggaggctccgttgcccaaagcagtcacgcagtca
gcggagatcaccattccggttactttcgaggcccgcgcccaaattgggggcccagaagct
gggaagtctgaacagtctggagccaagtag

DBGET integrated database retrieval system