KEGG   Mus musculus (mouse): 15516Help
Entry
15516             CDS       T01002                                 

Gene name
Hsp90ab1, 90kDa, AL022974, C81438, Hsp84, Hsp84-1, Hsp90, Hspcb
Definition
(RefSeq) heat shock protein 90 alpha (cytosolic), class B member 1
  KO
K04079  
molecular chaperone HtpG
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Necroptosis
Antigen processing and presentation
NOD-like receptor signaling pathway
IL-17 signaling pathway
Th17 cell differentiation
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Pathways in cancer
Prostate cancer
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15516 (Hsp90ab1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    15516 (Hsp90ab1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    15516 (Hsp90ab1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    15516 (Hsp90ab1)
   04612 Antigen processing and presentation
    15516 (Hsp90ab1)
   04659 Th17 cell differentiation
    15516 (Hsp90ab1)
   04657 IL-17 signaling pathway
    15516 (Hsp90ab1)
  Endocrine system
   04915 Estrogen signaling pathway
    15516 (Hsp90ab1)
   04914 Progesterone-mediated oocyte maturation
    15516 (Hsp90ab1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    15516 (Hsp90ab1)
   05215 Prostate cancer
    15516 (Hsp90ab1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    15516 (Hsp90ab1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15516 (Hsp90ab1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP90
   15516 (Hsp90ab1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15516 (Hsp90ab1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    15516 (Hsp90ab1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15516 (Hsp90ab1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B3; 17 22.59 cM
AA seq 724 aa AA seqDB search
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacctttgcctttcaggcagaa
attgcccagctcatgtccctcatcatcaacactttctattcaaacaaggagattttcctc
cgcgagttgatctctaatgcttcagatgccctggacaagattcgatatgagagcctgacg
gacccttctaagttggacagtgggaaagagctgaaaattgacatcatccccaaccctcag
gagcgcacgctgactttggtggacacaggcattggcatgaccaaggctgacctcattaat
aacctgggaaccattgctaagtctggcacgaaggcgttcatggaggctctccaggctggt
gcagacatctccatgatcgggcagtttggtgtcggattctactcggcctatctagttgca
gagaaagtggttgtgatcacgaagcacaatgatgatgagcagtatgcctgggagtcgtct
gcgggtggctccttcaccgtccgggcagaccatggtgagcccattggccggggtaccaaa
gtgatccttcacctcaaagaagaccagacagagtacttggaggagaggagggtcaaggaa
gtggtgaagaaacattcgcagttcataggctatcccatcaccctctatttggagaaggaa
cgggagaaggagatcagtgatgatgaggcagaggaagagaaaggtgagaaagaggaggaa
gataaggaggatgaggagaagcctaagattgaagatgtgggatccgatgaggaagatgac
agcggcaaagacaagaaaaagaaaacaaagaagatcaaagagaagtacattgaccaggag
gagctgaacaagacaaagcctatctggaccagaaacccggatgacatcacgcaggaggag
tatggcgaattctataagagcctcaccaatgactgggaggaccacttggcagtcaagcac
ttctctgtagaaggtcagttggaattcagggcattgctcttcattccccggcgggctccc
ttcgacctttttgagaacaagaagaagaagaacaacatcaaattgtatgtccgccgtgtg
ttcatcatggacagctgtgacgagctgatacctgagtacctcaactttatccgcggtgtg
gttgactccgaggacctgcccctgaacatctcccgggagatgctgcagcagagcaagatc
ctgaaggtcatccgcaagaacatcgtcaagaagtgcctggagctcttctccgagctggct
gaggacaaggagaactacaagaagttctatgaggccttctccaaaaatttaaagcttgga
attcatgaagattccactaaccgacgccgcctctctgagctccttcgctatcacacctct
cagtctggagatgagatgacctccttgtcagagtatgtgtctcgcatgaaggagacccag
aagtccatctactatatcactggtgagagcaaagagcaagtggccaactctgcctttgtg
gagcgagtgcggaagcggggcttcgaggtggtgtatatgactgagcctattgacgagtac
tgcgtgcagcagctcaaggagtttgatgggaagagcctggtctcagtgactaaggagggc
ctggagctaccagaggacgaggaagagaagaagaaaatggaggagagcaaggcaaagttt
gagaatctctgcaagctcatgaaggagatcttggacaagaaggttgaaaaggtgacaatc
tccaataggcttgtgtcttcaccctgctgcattgtgacaagcacctatggctggacagcc
aacatggaacggatcatgaaggcccaggcactgcgagacaactctacaatgggctacatg
atggccaaaaaacacctggagatcaaccctgaccaccccatcgtggagaccctgcggcag
aaggctgaggcagacaaaaacgacaaagctgtcaaggacctggtggtgctgctgtttgaa
actgctctgctctcctctggtttctcacttgaggatccccaaacccactccaaccgcatc
taccgcatgattaaactaggcctgggcatcgatgaagatgaggtcactgcagaggagccc
agtgctgctgttcctgatgagatcccccctctggaaggcgatgaggatgcctcgcgcatg
gaagaggtggattaa

DBGET integrated database retrieval system