KEGG   Mus musculus (mouse): 15516Help
Entry
15516             CDS       T01002                                 

Gene name
Hsp90ab1, 90kDa, AL022974, C81438, Hsp84, Hsp84-1, Hsp90, Hspcb
Definition
(RefSeq) heat shock protein 90 alpha (cytosolic), class B member 1
  KO
K04079  
molecular chaperone HtpG
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Antigen processing and presentation
NOD-like receptor signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Pathways in cancer
Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15516 (Hsp90ab1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    15516 (Hsp90ab1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    15516 (Hsp90ab1)
   04612 Antigen processing and presentation
    15516 (Hsp90ab1)
  Endocrine system
   04915 Estrogen signaling pathway
    15516 (Hsp90ab1)
   04914 Progesterone-mediated oocyte maturation
    15516 (Hsp90ab1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    15516 (Hsp90ab1)
   05215 Prostate cancer
    15516 (Hsp90ab1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15516 (Hsp90ab1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP90
   15516 (Hsp90ab1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15516 (Hsp90ab1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    15516 (Hsp90ab1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15516 (Hsp90ab1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B3; 17 22.59 cM
AA seq 724 aa AA seqDB search
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacctttgcctttcaggcagaa
attgcccagctcatgtccctcatcatcaacactttctattcaaacaaggagattttcctc
cgcgagttgatctctaatgcttcagatgccctggacaagattcgatatgagagcctgacg
gacccttctaagttggacagtgggaaagagctgaaaattgacatcatccccaaccctcag
gagcgcacgctgactttggtggacacaggcattggcatgaccaaggctgacctcattaat
aacctgggaaccattgctaagtctggcacgaaggcgttcatggaggctctccaggctggt
gcagacatctccatgatcgggcagtttggtgtcggattctactcggcctatctagttgca
gagaaagtggttgtgatcacgaagcacaatgatgatgagcagtatgcctgggagtcgtct
gcgggtggctccttcaccgtccgggcagaccatggtgagcccattggccggggtaccaaa
gtgatccttcacctcaaagaagaccagacagagtacttggaggagaggagggtcaaggaa
gtggtgaagaaacattcgcagttcataggctatcccatcaccctctatttggagaaggaa
cgggagaaggagatcagtgatgatgaggcagaggaagagaaaggtgagaaagaggaggaa
gataaggaggatgaggagaagcctaagattgaagatgtgggatccgatgaggaagatgac
agcggcaaagacaagaaaaagaaaacaaagaagatcaaagagaagtacattgaccaggag
gagctgaacaagacaaagcctatctggaccagaaacccggatgacatcacgcaggaggag
tatggcgaattctataagagcctcaccaatgactgggaggaccacttggcagtcaagcac
ttctctgtagaaggtcagttggaattcagggcattgctcttcattccccggcgggctccc
ttcgacctttttgagaacaagaagaagaagaacaacatcaaattgtatgtccgccgtgtg
ttcatcatggacagctgtgacgagctgatacctgagtacctcaactttatccgcggtgtg
gttgactccgaggacctgcccctgaacatctcccgggagatgctgcagcagagcaagatc
ctgaaggtcatccgcaagaacatcgtcaagaagtgcctggagctcttctccgagctggct
gaggacaaggagaactacaagaagttctatgaggccttctccaaaaatttaaagcttgga
attcatgaagattccactaaccgacgccgcctctctgagctccttcgctatcacacctct
cagtctggagatgagatgacctccttgtcagagtatgtgtctcgcatgaaggagacccag
aagtccatctactatatcactggtgagagcaaagagcaagtggccaactctgcctttgtg
gagcgagtgcggaagcggggcttcgaggtggtgtatatgactgagcctattgacgagtac
tgcgtgcagcagctcaaggagtttgatgggaagagcctggtctcagtgactaaggagggc
ctggagctaccagaggacgaggaagagaagaagaaaatggaggagagcaaggcaaagttt
gagaatctctgcaagctcatgaaggagatcttggacaagaaggttgaaaaggtgacaatc
tccaataggcttgtgtcttcaccctgctgcattgtgacaagcacctatggctggacagcc
aacatggaacggatcatgaaggcccaggcactgcgagacaactctacaatgggctacatg
atggccaaaaaacacctggagatcaaccctgaccaccccatcgtggagaccctgcggcag
aaggctgaggcagacaaaaacgacaaagctgtcaaggacctggtggtgctgctgtttgaa
actgctctgctctcctctggtttctcacttgaggatccccaaacccactccaaccgcatc
taccgcatgattaaactaggcctgggcatcgatgaagatgaggtcactgcagaggagccc
agtgctgctgttcctgatgagatcccccctctggaaggcgatgaggatgcctcgcgcatg
gaagaggtggattaa

DBGET integrated database retrieval system