KEGG   Mus musculus (mouse): 15558Help
Entry
15558             CDS       T01002                                 

Gene name
Htr2a, E030013E04, Htr-2, Htr2
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 2A
  KO
K04157  
5-hydroxytryptamine receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    15558 (Htr2a)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15558 (Htr2a)
 Cellular Processes
  Cellular community
   04540 Gap junction
    15558 (Htr2a)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    15558 (Htr2a)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    15558 (Htr2a)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    15558 (Htr2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 D2; 14 39.37 cM
AA seq 471 aa AA seqDB search
MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK
SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaaattctctgtgaagacaatatctccctgagctcaattccaaactccttaatgcaa
ttaggtgacgactcgaggctctaccctaatgacttcaactccagggatgctaacacttcc
gaagcctcgaactggacaattgatgctgaaaacagaaccaacctctcctgcgaagggtac
ctcccaccgacatgcctctccattcttcatctccaggaaaaaaactggtctgctttattg
acaactgtcgtgattattctcaccattgcgggaaacatactggtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctttgcccagcaagctctgtgccgtctggatttacctggatgtgctcttctccacg
gcgtccatcatgcacctctgcgccatctccctggaccgctacgtggctatccagaacccc
attcaccatagccgcttcaactccagaaccaaagccttcctgaaaatcattgcggtgtgg
accatatccgtaggtatatccatgccaatcccagtcttcgggctacaggatgattcgaag
gtctttaaggaagggagctgcctgctcgccgatgacaactttgtcctcataggctctttt
gtggcatttttcatccccctaaccatcatggtgatcacctacttcctgactatcaagtca
cttcagaaagaagccaccttgtgtgtgagtgacctcagcactcgggccaaattatcctcc
ttcagcttcctccctcagagttctctgtcatcagaaaagctcttccagcggtccatccac
agagagccaggctcctacgcaggccgaaggacgatgcagtccatcagcaacgagcaaaaa
gcatgcaaggtgctgggcatcgtgttctttctgtttgttgtaatgtggtgcccattcttc
atcaccaatatcatggccgtcatctgcaaagaatcctgcaatgaaaatgtcattggagcc
ctgctcaatgtgtttgtctggattggttatctctcctcagccgtcaacccactggtatat
acgttgttcaataaaacttataggtccgccttctcacggtacattcagtgccagtacaag
gagaacagaaagccgctgcagttaattttagtgaacactataccaacattggcctacaag
tctagtcagctccaggtgggacaaaaaaagaactcacaggaagatgctgagccgacagct
aatgactgctccatggttacactagggaaccaacactcggaagagatgtgtacagacaat
attgaaaccgtgaatgaaaaggttagctgtgtgtga

DBGET integrated database retrieval system