KEGG   Mus musculus (mouse): 15558Help
Entry
15558             CDS       T01002                                 

Gene name
Htr2a, E030013E04, Htr-2, Htr2
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 2A
  KO
K04157  
5-hydroxytryptamine receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    15558 (Htr2a)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15558 (Htr2a)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    15558 (Htr2a)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    15558 (Htr2a)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    15558 (Htr2a)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    15558 (Htr2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 D3; 14 39.37 cM
AA seq 471 aa AA seqDB search
MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK
SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaaattctctgtgaagacaatatctccctgagctcaattccaaactccttaatgcaa
ttaggtgacgactcgaggctctaccctaatgacttcaactccagggatgctaacacttcc
gaagcctcgaactggacaattgatgctgaaaacagaaccaacctctcctgcgaagggtac
ctcccaccgacatgcctctccattcttcatctccaggaaaaaaactggtctgctttattg
acaactgtcgtgattattctcaccattgcgggaaacatactggtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctttgcccagcaagctctgtgccgtctggatttacctggatgtgctcttctccacg
gcgtccatcatgcacctctgcgccatctccctggaccgctacgtggctatccagaacccc
attcaccatagccgcttcaactccagaaccaaagccttcctgaaaatcattgcggtgtgg
accatatccgtaggtatatccatgccaatcccagtcttcgggctacaggatgattcgaag
gtctttaaggaagggagctgcctgctcgccgatgacaactttgtcctcataggctctttt
gtggcatttttcatccccctaaccatcatggtgatcacctacttcctgactatcaagtca
cttcagaaagaagccaccttgtgtgtgagtgacctcagcactcgggccaaattatcctcc
ttcagcttcctccctcagagttctctgtcatcagaaaagctcttccagcggtccatccac
agagagccaggctcctacgcaggccgaaggacgatgcagtccatcagcaacgagcaaaaa
gcatgcaaggtgctgggcatcgtgttctttctgtttgttgtaatgtggtgcccattcttc
atcaccaatatcatggccgtcatctgcaaagaatcctgcaatgaaaatgtcattggagcc
ctgctcaatgtgtttgtctggattggttatctctcctcagccgtcaacccactggtatat
acgttgttcaataaaacttataggtccgccttctcacggtacattcagtgccagtacaag
gagaacagaaagccgctgcagttaattttagtgaacactataccaacattggcctacaag
tctagtcagctccaggtgggacaaaaaaagaactcacaggaagatgctgagccgacagct
aatgactgctccatggttacactagggaaccaacactcggaagagatgtgtacagacaat
attgaaaccgtgaatgaaaaggttagctgtgtgtga

DBGET integrated database retrieval system